(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE45

CP001994.PE45        Location/Qualifiers
FT   CDS_pept        49433..50266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0046"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="COGs: COG1173 ABC-type dipeptide/oligopeptide/nickel
FT                   transport systems permease components; InterPro IPR000515;
FT                   KEGG: dde:Dde_2594 oligopeptide ABC transporter, permease
FT                   protein; PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; SPTR: Q8TIA4 Oligopeptide ABC
FT                   transporter, permease protein; PFAM:
FT                   Binding-protein-dependent transport system inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35583"
FT                   /db_xref="GOA:D5E8S4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D5E8S4"
FT                   /protein_id="ADE35583.1"
FT                   /translation="MIKGIFNRSMLIGLILIGAVVFLALAAPWLAPQDPQKTNFDQRLL
FT                   SPSSEYPFGTDHLGRCILSRVLFAARISLFIGASVIAISFIAGTLIGSVSAYAGGIVDE
FT                   TVMRFVDGFLAFPSMFIALAIAGIFGGNMTGLIIALSIVEWTAYARVSRGSVLTVKNVD
FT                   YIAVSRMMGGRAPYILRHHILPNITSPLLVISTLGMGNVILAAAGLSFLGLGVSSAPEW
FT                   GMMVNEGRLFLQSAPHVMFFPGIFIVITVLGFNFLGDGLRDIFDPRDTKQRWRLF"
     atgataaagg gaatatttaa cagaagtatg ctgattggcc ttattctcat tggggcagta        60
     gtgttccttg cactggcagc tccgtggttg gctcctcagg atccccagaa aaccaatttt       120
     gaccagagat tgttatctcc ttcttcagaa tatccttttg gaaccgatca tctgggacga       180
     tgtatcttaa gcagggttct gtttgctgcc cgcattagcc tgtttatagg agcttctgtt       240
     atagcaatat cttttatcgc cggcacatta attggttcag tctcagctta tgccggaggt       300
     attgtagatg aaaccgtgat gagatttgtc gatggttttc ttgcatttcc cagtatgttt       360
     attgctcttg ccattgccgg catattcgga gggaatatga cgggattgat cattgctttg       420
     tcgatagttg aatggactgc ttatgccaga gtgagccgtg gctctgttct gacggtgaaa       480
     aacgtggatt atatcgcagt ctcgagaatg atgggaggca gggctcccta tatactacgt       540
     catcatattc tgccaaatat tacatccccc ttgcttgtaa tctcaaccct tggtatggga       600
     aacgttattt tggcagctgc cggattgagt ttcctgggat tgggtgtatc atctgctcca       660
     gaatggggaa tgatggtcaa tgaaggccgc ctgttcctac aatccgctcc ccacgttatg       720
     tttttcccgg ggatatttat tgtaataact gtcttgggtt tcaacttcct cggggatgga       780
     ttgagggata tttttgatcc acgagataca aaacagcgtt ggaggttgtt ctga             834
//

If you have problems or comments...

PBIL Back to PBIL home page