(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE452

CP001994.PE452       Location/Qualifiers
FT   CDS_pept        480146..480676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0460"
FT                   /product="integrase family protein"
FT                   /note="COGs: COG4974 Site-specific recombinase XerD;
FT                   InterPro IPR002104; KEGG: sdn:Sden_1137 phage integrase;
FT                   PFAM: integrase family protein; SPTR: A8TGC2 Integrase
FT                   family protein; PFAM: Phage integrase family"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35990"
FT                   /db_xref="GOA:D5E9Y9"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9Y9"
FT                   /protein_id="ADE35990.1"
FT                   /translation="MLNNPNISEKYEIWILLMYTPALRVTEAINIRVKDIDLEDECIDI
FT                   WGGKGRDVTELQKAPCNIRVLKRIKRFCEHSDLRPTGYIMYSQKSKQVNRSHVYKVFND
FT                   ICSESGINKTIGTHTMRRSRAEHLLDKGLPLTFVSKYLRYKNLSTTMKYLDVSVADIQR
FT                   EMEMIDDCVNALV"
     atgttgaata atcccaatat ttctgaaaaa tatgaaatat ggattctttt gatgtacact        60
     cctgcattaa gagtaaccga ggccatcaat atcagagtta aagatattga cttggaagat       120
     gaatgtattg atatctgggg tggcaagggt cgtgatgtta ccgaattgca gaaagctccc       180
     tgcaatattc gggtcttgaa acgaataaag cgattctgtg aacattcgga tcttcgacca       240
     acgggttaca ttatgtattc ccagaagtcc aaacaagtga atcgttccca tgtatataaa       300
     gtcttcaatg acatatgcag tgaatctgga attaacaaga caattggaac acatacaatg       360
     cgacgttcca gggcagaaca tttgttggat aaaggattac cattgacatt tgttagtaaa       420
     tacctgcggt acaagaattt gtcaactaca atgaagtatc tggatgtttc agtagctgat       480
     attcagcggg aaatggaaat gattgatgat tgcgttaatg cattggtttg a                531
//

If you have problems or comments...

PBIL Back to PBIL home page