(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE454

CP001994.PE454       Location/Qualifiers
FT   CDS_pept        481085..483922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0462"
FT                   /product="Substrate-binding region of ABC-type glycine
FT                   betaine transport system"
FT                   /note="COGs: COG2113 ABC-type proline/glycine betaine
FT                   transport systems periplasmic components; InterPro
FT                   IPR007210:IPR006457:IPR010916; KEGG: csa:Csal_1901
FT                   substrate-binding region of ABC-type glycine betaine
FT                   transport system; PFAM: Substrate-binding region of
FT                   ABC-type glycine betaine transport system; S-layer-related
FT                   duplication domain; SPTR: Q2KP08 Glycine-betaine binding
FT                   protein (Fragment); PFAM: Substrate binding domain of
FT                   ABC-type glycine betaine transport system; Protein of
FT                   unknown function (DUF1608); TIGRFAM: S-layer-related
FT                   duplication domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35992"
FT                   /db_xref="GOA:D5E9Z1"
FT                   /db_xref="InterPro:IPR006457"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9Z1"
FT                   /protein_id="ADE35992.1"
FT                   /translation="MKRLTVILMAALMVLIVFSGVASAADSVEVRGEAAVDTASFTWDA
FT                   DNFAGFWYDVDNGVFSETMDITRDASPSRNIDDGNLVYTATVQPESTEFDFAGETTTTG
FT                   AFTNYPIGKIGLFASEYYVVGDGQLSEVLMDTDVSYTMRTGETLELAEGYAITPQQINV
FT                   NDGKVWLELTKDGQFLDGKVIDVSGDNTAWIYEQDVMNEEDVVTLQINIDQVFQGQVDS
FT                   LCIVEGIFQISDTGLHIEKYDTFGKLIVTTVDSTQIVMENENSFNVPKDGTTEISEDFY
FT                   LRGNDNVGAPPNDIWYLATEYTEPGTYEVRGEAAVDASSFTWDADNFAGFWYDLDEDDS
FT                   SETMEINVTDDKDILEGDLVYTATAVDDQTTEFGFTESSTSATGFTYTKLGLFAEEYFV
FT                   VNDAIDTLSKILMDDDSSYTMRTGETLELEEGYAITPQQIDVDGNKVWLELTKDGEFVD
FT                   DKIISTSGDATQANKTWFYEQDIEDQEDVATIMVHVDEVFQGQVDSLCSIEGVFQISDE
FT                   AMVVQTDDEFGELEVTSIGTDSIEMANMDDLDVPDDGVLDITDELMVRGNDGATLWYLF
FT                   TERTIGGEEPVEPVEPEERTTSIGYVMWDGEIASTNVMKEVLEQAGYEVEIIAVDAGPL
FT                   YQGLADGQFDFTTSAWLPQTQANYWEQYGDQVDRVAVNLEDCKLGLAVPTYMEDINSIE
FT                   DLNANKEKFNGKITGIDPGAGIMQNTEDAIDMYNLDYDLEASSSAGMASALDGAYRDEQ
FT                   PIVVTLWTPHWAFDRYDLKMLDDPQQAYGEADHVETLARQGLEDDKPELYAIINRFNWT
FT                   HNEIQTVMADMEAGMSAEDAAANWVENNPDRVNEWINGSDSSSGSSGGGSGASYSTYNM
FT                   SLQKGWNLVSIPIIPESSVLSTFENTSDVLLPVYSWNTENKQYYEVEHLEIGRGYWVLA
FT                   LNDTEVNVEGATYYP"
     atgaaaagat taacagtaat tttaatggct gccctaatgg tcttaatagt attttctggc        60
     gtagcaagcg cagcagattc tgttgaagtc cgtggggaag ctgcagtaga tacagcatct       120
     ttcacatggg atgcagacaa ctttgcaggt ttctggtatg atgtcgacaa cggtgtcttc       180
     tctgaaacta tggacattac tagagatgct tccccttcaa gaaacattga tgacggcaac       240
     ttggtatata cagcaactgt tcaaccagaa tccacagaat ttgactttgc aggtgaaaca       300
     actaccactg gagcatttac caattatcca atcggtaaaa tcggcctttt tgcaagtgaa       360
     tactatgtgg ttggagatgg ccaactatcc gaagtcctaa tggacaccga tgtcagttac       420
     acaatgcgaa ccggtgagac tcttgagctc gctgaaggct atgcaatcac accacagcag       480
     atcaatgtta acgatggaaa agtatggctt gaacttacca aagacggtca attccttgat       540
     ggcaaggtaa ttgatgtctc cggtgacaac actgcttgga tctacgaaca ggacgtaatg       600
     aatgaagaag atgtagttac attgcagatc aacatcgatc aggttttcca gggacaggtt       660
     gatagccttt gtattgttga gggcatcttc caaatatctg acaccgggct tcacatcgaa       720
     aaatatgata cttttggtaa actcattgta acaactgtgg actctaccca gattgtaatg       780
     gagaatgaaa atagcttcaa tgtaccaaag gatggtacaa cagaaatctc tgaagatttc       840
     tacctgcgtg gaaacgacaa tgtaggtgct ccaccaaatg atatctggta tcttgcaact       900
     gaatatactg aacccggtac atacgaagtc cgtggagaag ctgcagtaga tgcatcatct       960
     ttcacatggg atgcagacaa ctttgcaggt ttctggtatg accttgatga agatgattca      1020
     tctgaaacaa tggaaatcaa tgtaactgat gacaaagata tcctcgaagg tgatttggtt      1080
     tacactgcaa ctgcagtaga tgatcagacc actgaatttg gatttactga aagctctaca      1140
     agtgctacag gatttaccta cacgaaactc ggactttttg ccgaggaata tttcgtagtt      1200
     aatgatgcaa ttgacaccct ttccaagatt ctcatggatg atgacagtag ttacaccatg      1260
     aggaccggtg agacactgga actcgaggaa ggttacgcaa tcacaccaca gcagatcgat      1320
     gttgacggaa acaaggtctg gcttgaactc accaaagatg gtgaattcgt agatgacaag      1380
     ataatctcta cctcaggtga tgctacacag gcaaacaaga cctggttcta tgaacaggat      1440
     attgaagacc aggaagatgt tgcaaccata atggtccatg ttgatgaagt gttccaagga      1500
     caggttgaca gtctctgttc catcgaaggt gtattccaga tttctgatga agcaatggta      1560
     gttcaaacag atgatgaatt cggtgaactt gaagtaacaa gcatcggtac tgattcaatc      1620
     gaaatggcaa acatggatga ccttgatgtt ccagatgatg gtgtccttga catcacagat      1680
     gaactaatgg tcagaggaaa cgatggtgca acactctggt atctcttcac tgagagaaca      1740
     attggaggcg aagaaccagt tgaaccagtt gaaccagaag aaagaaccac aagtattggt      1800
     tatgttatgt gggacggtga aattgccagt accaacgtaa tgaaagaggt ccttgaacag      1860
     gccggttacg aagtagaaat aatcgctgtt gatgcaggcc cactttacca gggacttgca      1920
     gacggccagt ttgactttac aacatctgcg tggcttccac aaacccaggc aaattactgg      1980
     gagcagtatg gagaccaggt tgacagagtt gcagtaaatc ttgaagattg caaactcggc      2040
     cttgcagtac caacctacat ggaagacatt aattccatcg aagacctgaa tgcaaacaag      2100
     gagaagttca atggaaagat caccggtatt gaccccggtg caggtataat gcagaacaca      2160
     gaagatgcaa tcgatatgta taatctggat tacgaccttg aagccagcag cagtgctgga      2220
     atggcatcag cccttgatgg tgcttacagg gacgaacaac caatcgttgt caccctctgg      2280
     acacctcact gggcattcga cagatatgac ctgaagatgc tggatgatcc acagcaggcc      2340
     tatggagaag ctgaccacgt agaaaccctt gccagacagg gactcgagga tgataaaccc      2400
     gaactctacg caatcataaa caggttcaac tggacccata atgagattca aaccgtaatg      2460
     gctgatatgg aagcaggaat gagtgctgaa gatgccgctg caaattgggt tgaaaacaat      2520
     cctgacagag ttaatgaatg gattaatggt tcggattcta gttcaggttc atccggtggt      2580
     ggaagtggag cttcatattc cacttataat atgtcactcc aaaagggttg gaaccttgtg      2640
     tcaatcccaa taattccaga atcatcggta ttgtcaactt ttgaaaatac aagtgatgtg      2700
     ttattgccgg tttattcttg gaatactgaa aataaacagt attatgaagt tgaacacctt      2760
     gaaattggta ggggatattg ggttcttgca ttaaatgata ctgaagtcaa tgttgaagga      2820
     gcaacatatt atccttga                                                    2838
//

If you have problems or comments...

PBIL Back to PBIL home page