(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE462

CP001994.PE462       Location/Qualifiers
FT   CDS_pept        490955..491320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0471"
FT                   /product="alkylhydroperoxidase like protein, AhpD family"
FT                   /note="COGs: COG0599 gamma-carboxymuconolactone
FT                   decarboxylase subunit; InterPro IPR003779:IPR004675; KEGG:
FT                   smd:Smed_3036 alkylhydroperoxidase; PFAM:
FT                   Carboxymuconolactone decarboxylase; SPTR: Q12Z58
FT                   Alkylhydroperoxidase family protein; TIGRFAM:
FT                   alkylhydroperoxidase like protein, AhpD family; PFAM:
FT                   Carboxymuconolactone decarboxylase family; TIGRFAM:
FT                   alkylhydroperoxidase AhpD family core domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ADE36000"
FT                   /db_xref="GOA:D5E9Z9"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9Z9"
FT                   /protein_id="ADE36000.1"
FT                   /translation="MSEHEELEHEELLDSMSNKLGFTPQILKTLGEIDPHFLKKYNHCN
FT                   QKLLSDGALPAKMKILMALAVVASKQCERCTVVQMQSALKNGATAEEIMETMEVISITS
FT                   GAPAVAACRDALKLLKE"
     atgtctgaac acgaagaact tgaacatgaa gaattactgg acagtatgag taacaaactg        60
     ggtttcactc cgcagatcct gaaaacattg ggcgagatcg atccgcattt cctgaaaaaa       120
     tacaatcatt gcaatcagaa actcctgtca gacggtgcgc tgcctgcaaa gatgaagatc       180
     cttatggcac ttgcagtggt ggcatccaag caatgtgaac gatgcacggt tgtacagatg       240
     cagagtgcct tgaaaaacgg ggctacggcc gaagagatta tggaaaccat ggaagtcata       300
     tccataacct cgggtgcacc cgcggtagct gcctgcaggg atgcgttgaa acttctcaag       360
     gaataa                                                                  366
//

If you have problems or comments...

PBIL Back to PBIL home page