(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE47

CP001994.PE47        Location/Qualifiers
FT   CDS_pept        51180..51971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0048"
FT                   /product="ABC transporter related protein"
FT                   /note="COGs: COG1123 ATPase components of various ABC-type
FT                   transport systems contain duplicated ATPase; InterPro
FT                   IPR003439:IPR003593; KEGG: pin:Ping_0561 ABC transporter
FT                   for peptide ATP-binding protein; PFAM: ABC transporter
FT                   related; SMART: AAA ATPase; SPTR: Q8TIA2 Oligopeptide ABC
FT                   transporter, ATP-binding protein; PFAM: ABC transporter;
FT                   Oligopeptide/dipeptide transporter, C-terminal region"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35585"
FT                   /db_xref="GOA:D5E8S6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5E8S6"
FT                   /protein_id="ADE35585.1"
FT                   /translation="MLEVKALDKSYSFSTIPFRKKRIKVLDNISFRINKHETLCIVGES
FT                   GCGKTTLAKCIVNLENPDNGKIILEGRDVTFPDRKTLYYLHTKVQMIFQNADTSLNPRH
FT                   HIYDSMAEPLRLQGQNEEKVRKRVFQLLDHVGLSEEHLHRHPHQLSGGQNQRIAIARAI
FT                   ALHPDLLIADEITAALDVSVQAQILQLLKTLKKEMDMTLLFISHDLALVKRIADRVAVM
FT                   QDGRLVEINDTNEIFHNPQCPYTKELISSMSQLSLDKQILK"
     gtgcttgaag taaaagcgct tgacaaaagt tattccttct caactatccc tttcaggaaa        60
     aaaagaatca aagtacttga taatatttct tttcggatta ataaacatga aacactttgc       120
     attgtaggag aaagcggctg tgggaaaaca actcttgcaa aatgtattgt aaatctggaa       180
     aaccccgata atggaaagat tatattggaa ggaagagatg ttacatttcc tgacaggaaa       240
     actctctatt atctccacac gaaggtacag atgatattcc agaatgcgga tacatcttta       300
     aatcccaggc atcacatata cgattcgatg gctgaacctc taagactgca aggtcaaaat       360
     gaggaaaaag tcaggaaaag agtattccaa ttactggatc atgtaggcct gtcagaagaa       420
     catctgcatc gacacccgca tcagttgagc ggtggacaga accagagaat tgctatagct       480
     cgtgcaatag ccctacatcc ggatttactc attgcagatg aaattactgc agctctggat       540
     gtctcggtac aggcccagat acttcaattg ctcaaaaccc tgaaaaaaga aatggacatg       600
     accttgcttt ttatatccca tgacctggcc cttgtcaagc gaatcgcaga cagggttgct       660
     gttatgcagg acggcagact tgttgagata aatgatacca atgagatatt ccataatcct       720
     caatgtccgt atacaaaaga gttaatttcg agtatgtccc aactttctct agataagcag       780
     attttaaaat aa                                                           792
//

If you have problems or comments...

PBIL Back to PBIL home page