(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE470

CP001994.PE470       Location/Qualifiers
FT   CDS_pept        complement(500934..501572)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0480"
FT                   /product="protein of unknown function DUF1271"
FT                   /note="COGs: COG3592 conserved hypothetical protein;
FT                   InterPro IPR018967:IPR010693:IPR006622; KEGG: mlo:mlr4660
FT                   hypothetical protein; PFAM: protein of unknown function
FT                   DUF1271; Iron sulphur domain-containing, CDGSH-type; SMART:
FT                   zinc finger CDGSH-type domain protein; SPTR: Q12YH8
FT                   Putative uncharacterized protein; PFAM: Iron-binding zinc
FT                   finger CDGSH type; Protein of unknown function (DUF1271)"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ADE36008"
FT                   /db_xref="GOA:D5EA07"
FT                   /db_xref="InterPro:IPR010693"
FT                   /db_xref="InterPro:IPR016548"
FT                   /db_xref="InterPro:IPR018967"
FT                   /db_xref="InterPro:IPR042216"
FT                   /db_xref="UniProtKB/TrEMBL:D5EA07"
FT                   /protein_id="ADE36008.1"
FT                   /translation="MDKEDKTIIKVSKDGPYIVSNLNTLRNSKGVFIETMPTIVMCRCG
FT                   GSGNKPFCDGTHMKNGFSGDKKEDRVPDKMDTYKGKAITIHDNRGVCSHMGHCTDNLPS
FT                   VFRMGIEPWIDPDGADPEEIARIIRMCPSGALSYTMDGQLHKDYPHDSEVFVGKDRSYN
FT                   VVGDIELEGPDGSKPETQDHYCLCRCGGSKNKPFCDGSHWHIEFEDEKN"
     atggataaag aagacaaaac catcataaaa gtatcaaaag acgggccata cattgtaagc        60
     aatctcaata ccctgcgtaa ttcaaaagga gtattcattg aaacaatgcc caccattgta       120
     atgtgcagat gtggaggatc cggaaacaag cctttttgtg atggtactca tatgaagaac       180
     ggtttttcag gggataagaa agaagatcgc gttcctgaca aaatggatac ttacaaagga       240
     aaagcaatca caatccatga caaccgcgga gtatgttccc atatgggcca ctgtaccgac       300
     aatttgcctt cggttttcag gatgggcatt gaaccctgga tcgaccctga tggcgctgat       360
     ccggaagaaa tcgcaagaat tatcaggatg tgcccgtccg gagcattgag ttacaccatg       420
     gatggacaat tgcacaaaga ttatccgcat gattcagaag tatttgtcgg gaaggaccgt       480
     tcctataatg ttgtgggaga tattgaactt gagggtccgg atggttctaa gcctgaaacc       540
     caggaccatt attgcctgtg cagatgcggt ggctccaaaa ataaaccatt ctgcgatggc       600
     agtcactggc acattgaatt cgaggatgag aaaaactga                              639
//

If you have problems or comments...

PBIL Back to PBIL home page