(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE471

CP001994.PE471       Location/Qualifiers
FT   CDS_pept        complement(501646..502071)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0481"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: scl:sce8824 hypothetical protein; SPTR: Q467T0
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ADE36009"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D5EA08"
FT                   /protein_id="ADE36009.1"
FT                   /translation="MNNDREDFWDKQSFVIITDNTKPAMKYTIDELNKRGKEVYIFDLS
FT                   ANPNKGDIKSVDDIPYNVENAVLGITTSNPADFVQALKNRGCSNFWIHWRTETPEIEDI
FT                   KDHDIQIIKGKCPMMYLGKDFSIHGLHRSIAKFAGKY"
     atgaacaacg acagggaaga tttctgggat aaacaatcct ttgtaataat aactgacaat        60
     accaaaccgg caatgaagta caccatagat gaactcaata aaagaggaaa agaagtgtat       120
     atttttgatt tgtccgctaa ccccaataaa ggggacataa aaagtgttga tgatatacca       180
     tacaatgtag aaaatgctgt actgggaatc acaacctcca atccggcaga ctttgtgcag       240
     gccctcaaaa acagaggatg ttctaatttc tggatacact ggcgcaccga aactcccgaa       300
     attgaagata taaaggatca tgatatacag ataatcaagg ggaaatgtcc aatgatgtac       360
     ctggggaagg atttcagcat ccatggtctg cacagatcaa tcgctaaatt tgcaggaaaa       420
     tattga                                                                  426
//

If you have problems or comments...

PBIL Back to PBIL home page