(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE472

CP001994.PE472       Location/Qualifiers
FT   CDS_pept        502615..502827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0482"
FT                   /product="S1 IF1 family protein"
FT                   /note="COGs: COG0361 Translation initiation factor 1
FT                   (IF-1); InterPro IPR001253:IPR006196:IPR018104; KEGG:
FT                   hypothetical protein; K03236 translation initiation factor
FT                   eIF-1A; PFAM: S1 IF1 family protein; SMART: initiation
FT                   factor 1A (eIF-1A); SPTR: Q8PUJ8 Translation initiation
FT                   factor 1A 2; PFAM: Translation initiation factor 1A / IF-1;
FT                   TIGRFAM: eukaryotic/archaeal initiation factor 1A"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ADE36010"
FT                   /db_xref="GOA:D5EA09"
FT                   /db_xref="InterPro:IPR001253"
FT                   /db_xref="InterPro:IPR006196"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018104"
FT                   /db_xref="UniProtKB/TrEMBL:D5EA09"
FT                   /protein_id="ADE36010.1"
FT                   /translation="MLGGKRLDLQCMDGVVRMGRIPGSRKRRMRIREGDVVLAIPWDIQ
FT                   DSKADVVWKYRRQEVAWLQKKGYLK"
     atgcttggag gcaaaagact cgaccttcaa tgtatggatg gcgttgtaag aatgggaaga        60
     attcccggtt cccgtaaaag acgtatgaga atacgggaag gtgatgttgt tcttgcaata       120
     ccgtgggata ttcaggattc aaaagccgat gtcgtctgga aatacagaag acaggaagtt       180
     gcctggcttc agaaaaaagg ttatctgaaa tga                                    213
//

If you have problems or comments...

PBIL Back to PBIL home page