(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE485

CP001994.PE485       Location/Qualifiers
FT   CDS_pept        complement(513334..513729)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0495"
FT                   /product="response regulator receiver protein"
FT                   /note="COGs: COG0784 FOG: CheY-like receiver; InterPro
FT                   IPR001789; KEGG: gur:Gura_2117 putative PAS/PAC sensor
FT                   protein; PFAM: response regulator receiver; SMART: response
FT                   regulator receiver; SPTR: Q12TT1 Response regulator
FT                   receiver; PFAM: Response regulator receiver domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ADE36023"
FT                   /db_xref="GOA:D5EA22"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:D5EA22"
FT                   /protein_id="ADE36023.1"
FT                   /translation="MSGEKILVVEDENIVALGIKKMLKGMGFRVPSIAASGEEAIQKAE
FT                   ITFPDLVLMDIMLKGKIDGIKAAETIYDTMDIPVVYLTAYSDDKILERSKKTNPYGYLI
FT                   KPFEEKTLQNTIKVALDNYRKEKEKKE"
     atgtcaggtg aaaaaattct cgtggtagaa gatgaaaata tagtagccct tggcataaaa        60
     aaaatgctca aaggaatggg tttcagggta cccagcatag cagcctcagg tgaagaggct       120
     atacaaaaag ctgagatcac ttttccggat cttgtactta tggatataat gctgaaaggt       180
     aaaattgatg ggattaaagc agctgaaaca atatatgaca ccatggacat acctgtcgta       240
     taccttacag cttattcgga tgataaaata cttgaaaggt caaaaaaaac aaacccctac       300
     ggctatctta taaagccctt tgaggaaaaa actctgcaaa atactattaa agtagctctg       360
     gacaattaca ggaaagaaaa agaaaaaaag gagtga                                 396
//

If you have problems or comments...

PBIL Back to PBIL home page