(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE486

CP001994.PE486       Location/Qualifiers
FT   CDS_pept        complement(513719..515986)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0496"
FT                   /product="signal transduction histidine kinase"
FT                   /note="COGs: COG3920 Signal transduction histidine kinase;
FT                   InterProIPR013655:IPR011495:IPR003594:IPR003660:IPR
FT                   000700:IPR005467; KEGG: ppd:Ppro_3009 hypothetical protein;
FT                   PFAM: histidine kinase dimerisation/phosphoacceptor; PAS
FT                   fold-3 domain protein; ATP-binding region ATPase domain
FT                   protein; histidine kinase HAMP region domain protein;
FT                   SMART: ATP-binding region ATPase domain protein; SPTR:
FT                   Q12XN1 Multisensor signal transduction histidine kinase;
FT                   PFAM: Histidine kinase; Cache domain; Histidine kinase-,
FT                   DNA gyrase B-, and HSP90-like ATPase; PAS fold"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ADE36024"
FT                   /db_xref="GOA:D5EA23"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011495"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D5EA23"
FT                   /protein_id="ADE36024.1"
FT                   /translation="MIEMTWKDVPLKSKLMFFILMGILVVLITSTAVIISTVTTQEEDL
FT                   AYQQSIQKAKNYANQFDIEMRSNQATGQAIAHSLSQYHSENRTEVNNILLKLLEENPDL
FT                   LGTYVCFEPNAFDGMDSRYVNTTGHDETGRFIPYWNRIPGNITLDPLLDYDTSVYYQLP
FT                   KEIKKDIVTEPYYYEGVFIVSYVTPVMRGGEFIGIGGVDVSLNHLNGVVNNVKAFDTGY
FT                   AIMTGNTGILISHPTNEELVGAKTLYDYGVPEITRMADEIKLGKSGYIETIDPITGKDV
FT                   VMFYEPIKTSKFAFILVVPKDEMLAGVTDLRNRLLLISSISLIFMGAIAILITRSVTGP
FT                   INEIVNDFKNISDAAIGGKLDERAETDVDIDFREIPEGLNDILNALENASQLREEMEKV
FT                   VNNSPVIVFKWKAEKNWPVEFVSKNISQFGYSPEDFGPNGLDYGDIIHPDDLPGVETKL
FT                   GEICSGKETQFNIEYRILTKDGETRWVDERTFIQRNQREIIHNMINKDNDIDSQVSDLK
FT                   GKCHDVKYLQGVIVNIDERKQAEEALLKIEDIRKKEIHHRIKNNLQVISTLLYLESEKF
FT                   KDDDVLDAFNNSRDRVRTMALVHEKLYQSKDMESIDFSDYSKNLINYLSQSYVLEKSEV
FT                   DIKINVENIFLGMDTAVPLGIIINELVSNSLKYAFDKGKGTIIVELRKINDHHKLVVSD
FT                   NGIGMKDEIDFEDTDSLGLLLVHTLAEQINATIEIDTSKGTKFEITFQEKNQELREGED
FT                   VR"
     atgattgaaa tgacatggaa agatgtacca ctaaaatcca aacttatgtt ttttatcctg        60
     atggggatac ttgtggtact gattacatcc actgcagtga tcatttcaac agtgacaacc       120
     caggaagagg accttgcata ccagcaatca atacagaaag cgaaaaacta tgctaatcag       180
     tttgatattg aaatgcgatc aaaccaggct acaggccagg cgattgcaca ttctctttca       240
     cagtatcatt cagagaaccg tacagaagta aacaatattt tactaaagct gctggaagaa       300
     aatcctgact tactgggaac ctatgtctgt tttgaaccca atgcatttga tgggatggat       360
     agtcgttatg taaatacaac cggccatgat gaaaccggga ggtttattcc ctactggaac       420
     aggataccgg gaaatataac acttgaccca ctacttgatt atgatacgtc agtatattac       480
     cagctgccaa aagagataaa gaaggatatc gttactgaac cctattacta tgagggtgta       540
     ttcattgtaa gttatgtcac acccgttatg cgagggggtg agtttattgg catcgggggg       600
     gtcgatgtat ccctgaatca tctgaatggt gtagtaaaca atgtaaaggc ctttgatacc       660
     ggctatgcga ttatgactgg gaatacagga attctcatat cccatcctac aaatgaagaa       720
     cttgtgggag caaaaaccct ctatgactac ggtgtaccgg aaattacacg catggctgat       780
     gaaataaaac tcggcaaaag cggctatatt gaaacaatcg atcctattac cggcaaagat       840
     gtggtcatgt tctatgaacc aataaagact tcaaaatttg catttatcct ggtggtacca       900
     aaggatgaga tgcttgcagg agtaacagac ctcaggaata gattactttt gatttcctca       960
     atatcattga tattcatggg agctattgca atcttgatta ccagatcggt gacaggccca      1020
     ataaatgaaa tagtgaacga ctttaagaac atatctgatg cagctatcgg agggaaactt      1080
     gatgaaaggg ccgaaacaga tgtagatatt gatttcaggg aaatacctga agggttgaat      1140
     gatatactca atgctcttga aaacgccagc cagttacgag aagagatgga aaaagttgtc      1200
     aacaacagcc cggtaattgt attcaagtgg aaagcagaaa agaactggcc tgttgaattt      1260
     gtatcaaaga acatatccca gtttggatat tctccggaag atttcggacc gaatggtctt      1320
     gattacgggg atattataca tccggatgat cttcccgggg ttgagacaaa actgggagaa      1380
     atatgctccg gtaaggaaac ccagtttaat atagagtaca ggatactgac aaaagacggt      1440
     gaaacccgat gggtcgatga gcgtaccttc atccagagaa atcagcgtga aatcatacat      1500
     aatatgatta ataaagataa tgatatcgac agccaggttt ctgacctgaa aggcaaatgc      1560
     catgatgtga aatatctcca gggcgtaata gtgaatatcg atgaaaggaa acaagctgaa      1620
     gaagcccttc ttaaaattga ggatatacgg aaaaaagaaa tacatcaccg gataaagaat      1680
     aatcttcagg taatatctac actattgtac cttgaatctg aaaaattcaa ggatgatgat      1740
     gtgctggatg ctttcaataa tagcagggac agagttcgca caatggccct tgtacatgag      1800
     aaactttacc agtcaaaaga catggagagt attgattttt cagactatag caaaaatctt      1860
     atcaattatc tttcccaatc ctatgtgttg gaaaaaagtg aagtcgatat aaaaattaat      1920
     gtagaaaaca tatttttggg aatggataca gcggtgccac ttggaataat tattaatgaa      1980
     ctggtatcca attcattaaa gtatgctttt gataaaggaa aaggtactat aatagtcgaa      2040
     cttcgaaaaa taaatgacca tcacaagctg gttgtcagtg acaatggtat cgggatgaag      2100
     gatgaaattg atttcgaaga tacagattcc cttggccttt tgcttgtcca tacacttgca      2160
     gaacagatca atgcaacaat agaaatagac acatcaaaag gcacaaagtt tgaaattact      2220
     ttccaggaaa aaaatcaaga actaagagag ggcgaagatg tcaggtga                   2268
//

If you have problems or comments...

PBIL Back to PBIL home page