(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE488

CP001994.PE488       Location/Qualifiers
FT   CDS_pept        517092..517703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0498"
FT                   /product="dimethylamine corrinoid protein"
FT                   /note="COGs: COG5012 cobalamin binding protein; InterPro
FT                   IPR006158:IPR003759:IPR012741; KEGG: geo:Geob_2541
FT                   cobalamin B12-binding domain protein; PFAM: cobalamin
FT                   B12-binding domain protein; Methionine synthase B12-binding
FT                   module cap domain protein; SPTR: Q12W94 Dimethylamine
FT                   corrinoid protein; TIGRFAM: methyltransferase cognate
FT                   corrinoid protein; PFAM: B12 binding domain; TIGRFAM:
FT                   methyltransferase cognate corrinoid proteins,
FT                   Methanosarcina family"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ADE36026"
FT                   /db_xref="GOA:D5EA25"
FT                   /db_xref="InterPro:IPR003759"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR012741"
FT                   /db_xref="InterPro:IPR036594"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="UniProtKB/TrEMBL:D5EA25"
FT                   /protein_id="ADE36026.1"
FT                   /translation="MSDAIVSCKKDQVLAAVEKARGELEAPDIIENGLAAGMNEVGTLF
FT                   ERGKLFLPHVMMAAEAMQAGVDELKDDMPEASEKAVSVIVNGTVEGDVHDIGKSIVSTM
FT                   LQTSGFEVHDIGRDTPVADFIAKIKETDANMVGISALMTTTLQGQKEVIEALEEEGLRD
FT                   KVKVMVGGAPATNSWAKKIGADCYAENATEAVNKAKELLL"
     ttgtctgacg ctattgtcag ttgcaagaaa gatcaggttc ttgctgctgt cgagaaagcc        60
     cgtggtgaac tcgaggctcc cgacataatc gagaatggtc ttgcagcagg tatgaatgaa       120
     gtcggtaccc tttttgaaag gggtaaactt ttccttccac atgtcatgat ggctgcagaa       180
     gccatgcagg ccggtgtgga cgaactcaaa gacgatatgc ctgaagcatc cgaaaaggct       240
     gtcagcgtaa tagtcaatgg tacagtagag ggagatgtcc atgacattgg caaatccatt       300
     gtatccacca tgctccagac ctcaggcttc gaagttcatg acattggccg tgatacacct       360
     gtagcggatt tcattgccaa gatcaaggaa acagacgcaa acatggtcgg catttccgca       420
     cttatgacca ccactctcca gggccagaag gaagtaatcg aagcccttga agaagaaggt       480
     ctccgtgaca aggtaaaagt catggtaggc ggtgcccctg caaccaactc ttgggccaaa       540
     aagattggtg cagattgtta tgcagaaaac gcaacagaag ctgtcaacaa agcaaaggaa       600
     cttctcttat aa                                                           612
//

If you have problems or comments...

PBIL Back to PBIL home page