(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE49

CP001994.PE49        Location/Qualifiers
FT   CDS_pept        52995..54719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0050"
FT                   /product="Cna B domain protein"
FT                   /note="InterPro IPR008454; KEGG: gme:Gmet_2043 hypothetical
FT                   protein; PFAM: Cna B domain protein; SPTR: Q2Y4X4 Putative
FT                   uncharacterized protein C5_0029"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35587"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR026428"
FT                   /db_xref="InterPro:IPR033764"
FT                   /db_xref="UniProtKB/TrEMBL:D5E8S8"
FT                   /protein_id="ADE35587.1"
FT                   /translation="MKSKIKLIVLVAIIFAIISIATAENAEAEECCPVDIPSAIITIEA
FT                   GTVPGSNGNYFDVQLSNVPAGYDISNGTWTGWCADSEVFITPETLYDTNVYCSESSSMP
FT                   GYTNDDEQWDKVNYVINRYRNGAYDSQLNSTSKADWQEVQAAIWNLTDANPNYQGYFTT
FT                   ASQYIIDDAHANGTGFCPGDNDIAIVVIDPYETPDDRKQLIFIEVGAMIDIEKSTNGED
FT                   ADNKTGPLVLNGNNVEWTYNVTNTGYYNLTDVSVTDDKLGHIGTISLLQAGQSQEFTVN
FT                   GIANPGQYGNNATVVGTPPSGPNVSDSDPSHYFGVNATIGDFLWDDTANNNGIQEPGES
FT                   GIAGVNVSLYNFSDDSLLQTTKTNESGYYNFSVTAGQYYIKFDLLNGYLFSPENQGTDN
FT                   EHDSDVDPSTAKTGKIDVQTTDFNMSFDAGMFKAIPGIDIEKSTNGEDADNETGPYIRL
FT                   NYEVSWVYNVTNTGNVNLTSIDVTDDELGLIGTIPLLQPGQSHVLTENATASLGQYENT
FT                   ATAVGVPPIGPNVTDSDMSHYFGHDSQPGFDVPTANPLLIIGMLGLAGAMVLRREQE"
     atgaagtcta aaattaaact aatcgtatta gttgcaatca tttttgcaat aatttcaata        60
     gcgactgcag aaaatgcaga ggcagaggaa tgctgtcccg tagatatacc ctctgcgata       120
     atcacgatcg aagcgggaac tgtacctggt agtaatggga attattttga tgtacaactg       180
     agtaatgttc ctgcaggcta cgatataagt aatgggacat ggactggctg gtgtgccgac       240
     agtgaagtat tcattacacc tgaaacattg tatgatacta atgtctattg cagtgagagt       300
     tcctcaatgc ctggctacac gaatgatgat gaacaatggg acaaggtcaa ttatgtaatt       360
     aacagatacc gtaatggagc ctatgattct caattaaatt cgacatccaa agcagattgg       420
     caagaagttc aggctgcaat ctggaacctt acagatgcga atccaaatta ccaaggatat       480
     tttacaacgg catctcaata tattatcgat gatgcacatg caaacggaac tggtttttgt       540
     ccgggtgaca atgatattgc tatcgtggtg atagatccgt atgaaactcc agatgaccgt       600
     aaacaactga tattcattga agtaggtgcc atgatagata tcgagaaatc taccaatgga       660
     gaagatgctg acaataaaac tggtccactg gtacttaatg gaaacaatgt tgaatggacc       720
     tataatgtga caaataccgg ttattacaat ttgacagatg tcagtgtgac cgatgacaaa       780
     cttgggcaca taggcactat ctcgctattg caggcaggcc aatcacagga attcacagta       840
     aatggaattg ctaacccggg acaatatgga aacaatgcaa cagtggttgg tacaccgcca       900
     tcaggtccca atgtcagtga ttcagatcca agccactatt ttggagttaa tgcaacaata       960
     ggcgatttcc tgtgggatga tacggcaaac aacaatggaa tccaggaacc gggtgaatcc      1020
     ggcattgctg gtgtaaacgt tagcctctac aacttcagtg atgattcatt gctgcagaca      1080
     accaaaacca atgaaagtgg ttactacaac ttcagtgtca ctgcagggca gtattacata      1140
     aaattcgatc tgctgaatgg ttacctcttc agtccagaaa accagggtac tgacaatgaa      1200
     cacgatagtg acgttgaccc ctccactgcg aagacaggaa aaatagacgt tcaaacaact      1260
     gatttcaata tgagtttcga tgcaggaatg tttaaagcaa tccctggtat tgatatcgag      1320
     aaatctacca atggagagga tgcggacaat gagacagggc catacatccg attaaactat      1380
     gaagtaagct gggtctacaa tgtgaccaat accggaaatg tcaatctgac cagtattgat      1440
     gtgaccgatg atgaacttgg attgattggc acgattccat tgttacagcc ggggcaatct      1500
     catgtattga ccgaaaacgc aactgccagt ttgggccaat atgagaacac agcaacagct      1560
     gtaggtgtgc caccaattgg tcccaatgta accgactcgg acatgagtca ttacttcggc      1620
     catgattcgc aacccggctt tgatgtccca acggcaaatc ccctgttaat aataggaatg      1680
     ctgggacttg caggtgcaat ggttttgaga agggaacagg agtaa                      1725
//

If you have problems or comments...

PBIL Back to PBIL home page