(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE50

CP001994.PE50        Location/Qualifiers
FT   CDS_pept        54876..56186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0051"
FT                   /product="Xanthine/uracil/vitamin C permease"
FT                   /note="COGs: COG2252 Permease; InterPro
FT                   IPR011547:IPR006043; KEGG: gsu:GSU1019 xanthine/uracil
FT                   permease family protein; PFAM: Xanthine/uracil/vitamin C
FT                   permease; sulphate transporter; SPTR: A8TED9
FT                   Xanthine/uracil/vitamin C permease; PFAM: Permease family"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35588"
FT                   /db_xref="GOA:D5E8S9"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="InterPro:IPR026033"
FT                   /db_xref="UniProtKB/TrEMBL:D5E8S9"
FT                   /protein_id="ADE35588.1"
FT                   /translation="MTGVLENFFHLKEHGTDIKTEVMAGLVTFMTVAYIIVVNPAILEA
FT                   AGIPFGPSLVATILSAVFGTLIMGVYAKKPIAIAPYMGENAFVAYTVVGVLGYPWQTAL
FT                   GAVFISGVLFTILTISGFRDKMIDAVPNNLKYSFVAGLGLFITFIGLVNAGIVSLGVEG
FT                   SPLHVGALDTMPVALAVLGFLLISILMIKNVKGSILIGIIATALLGFVTGISQTPDSIV
FT                   SMPPSLTPIFLQLDIFGALSWGFFAVILTMFTMDLMDTMGTLVGVSMEAGYMDEQGNLP
FT                   DMEKPFLADSLATVFAAIAGTTTTGAYIESATGIKEGGRTGLTAVVVALLFMLGLFFYP
FT                   LFSAIPAAATAPALIIVGFQMMASIKKIDMNDLTEMVPAMAVIILMSFTYNLGIGLCAG
FT                   FVLFPLFKVVSGKSSEVKPIAWGLFVLCTLFFVFYPY"
     atgacaggcg tactggaaaa cttttttcat ctgaaagaac acggcacaga tataaagacc        60
     gaagttatgg ccggccttgt caccttcatg acagttgcct acattatagt tgtcaatcct       120
     gccatcctag aagctgcagg gatacccttc ggcccttctc tggtggccac aatcctttcc       180
     gcggtatttg gaaccctcat aatgggtgtc tatgccaaaa aacccattgc gattgcaccc       240
     tatatgggag agaatgcttt tgttgcttat acggttgtag gggtgctggg ttatccctgg       300
     cagacggcac tgggtgcagt attcataagc ggtgtccttt ttacaattct gacaatttca       360
     ggtttcaggg acaaaatgat cgatgcagtc ccgaataacc tcaaatacag ttttgtagcc       420
     ggtctgggtc tgtttataac ctttatcggg cttgttaatg caggtattgt ttcgctggga       480
     gtggaagggt ctccccttca tgtaggtgcc ctggatacaa tgcctgtagc ccttgctgta       540
     ctgggatttc ttttaatcag catcctgatg atcaaaaatg tcaagggatc aattctgata       600
     ggtatcattg ctacagctct tttgggattt gtgacaggta tttcccaaac accggattcg       660
     atagtcagca tgccgccaag tcttacaccc attttcctgc agctggatat ttttggcgcc       720
     ttatcctggg gtttctttgc cgtgatcctt acaatgttta ccatggacct gatggataca       780
     atgggtaccc ttgtgggtgt atccatggag gccgggtata tggatgagca gggcaatctt       840
     cctgatatgg aaaaaccttt ccttgcagac tccctggcta cagtattcgc agcaattgcc       900
     ggtaccacta ccacaggtgc atacatcgaa tctgctaccg gtataaaaga aggaggcagg       960
     accgggctta ctgcagtcgt ggttgcactt cttttcatgc tgggcctgtt cttctatccc      1020
     ctcttttcag caatcccggc agctgccaca gctcctgctt tgataattgt cggttttcag      1080
     atgatggcat cgatcaaaaa gatagatatg aatgatttga ccgagatggt ccctgcaatg      1140
     gcggttataa tcctgatgag ctttacctat aacctgggaa ttggtctgtg tgcaggtttt      1200
     gtcctgtttc ctctttttaa agtggtaagt ggcaaaagta gtgaagttaa accaatagcc      1260
     tggggactgt ttgtcctgtg tactctgttt tttgtattct atccgtactg a               1311
//

If you have problems or comments...

PBIL Back to PBIL home page