(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE504

CP001994.PE504       Location/Qualifiers
FT   CDS_pept        531596..532804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0515"
FT                   /product="Phosphopantothenoylcysteine decarboxylase;
FT                   Phosphopantothenate-cysteine ligase"
FT                   /EC_number="4.1.1.36"
FT                   /EC_number="6.3.2.5"
FT                   /note="COGs: COG0452 Phosphopantothenoylcysteine
FT                   synthetase/decarboxylase; InterPro
FT                   IPR007085:IPR003382:IPR005252; KEGG: gbm:Gbem_1667
FT                   phosphopantothenoylcysteine
FT                   decarboxylase/phosphopantothenate--cysteine ligase; PFAM:
FT                   DNA/pantothenate metabolism flavoprotein domain protein;
FT                   flavoprotein; SPTR: Q466Q5 Phosphopantothenate-cysteine
FT                   ligase / Phosphopantothenoylcysteine decarboxylase;
FT                   TIGRFAM: phosphopantothenoylcysteine
FT                   decarboxylase/phosphopantothenate/cysteine ligase; PFAM:
FT                   DNA / pantothenate metabolism flavoprotein; Flavoprotein;
FT                   TIGRFAM: phosphopantothenoylcysteine
FT                   decarboxylase/phosphopantothenate--cysteine ligase,
FT                   prokaryotic"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ADE36042"
FT                   /db_xref="GOA:D5EA41"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR005252"
FT                   /db_xref="InterPro:IPR007085"
FT                   /db_xref="InterPro:IPR035929"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:D5EA41"
FT                   /protein_id="ADE36042.1"
FT                   /translation="MHSTLWIKGTKSKSLEGKTVVLAVTGSIAAVRVVELARELIRNGA
FT                   NVYAVMSEAATRILHPDALHYATGHEVITDITGGVEHVGMCGLQGMADLLLIAPATANT
FT                   ISKIAMGIDDTPVTTFATTAIGSGVATIVVPAMHQSMYDHPAVNSNLEKLGSYGISLVG
FT                   PRVEEGIAKIAPNDDIVLAVERELMGKKLAGKKIVLTSGATAEAIDPIRIITNRASGKT
FT                   GQELAREAFRRGGDVTIIHRNELDADGINEVYAESAASMLDSCMEEIGRGCDVFISSAA
FT                   ISDYTLDSLGSKIKSGQKLILEMHPTEKILPQVRSNYPAIVTVGFKAETGVGEKELVGS
FT                   ATRMLEEYGLDMVVANDVMAGGMGTSENSIYILQDESSASHYSGSKRYLASIIMDRVEQ
FT                   ILL"
     atgcattcta cactatggat caaaggaact aaaagtaaat cccttgaggg aaagaccgtt        60
     gtgctggcag ttactggcag tattgcagcc gtacgtgttg tggaactggc acgtgaacta       120
     atacgcaacg gtgcaaatgt ctatgctgtg atgagtgaag cggcaacgcg tattctccat       180
     cctgatgcat tacattatgc caccggtcat gaagtgatta cggatataac cgggggagtg       240
     gagcatgtgg gaatgtgcgg actgcagggt atggcagatc tcttattgat agctccggca       300
     acggcgaata ctataagcaa aattgcaatg gggattgatg acacacctgt aacgactttt       360
     gcaactactg ctattggtag tggggtggcc acaatagttg tacctgcaat gcatcaatcg       420
     atgtatgatc atcctgcagt gaattccaat ctcgaaaaac ttggaagtta tggtatcagt       480
     ctagttggtc cccgtgtaga ggaagggatt gccaagatag ctccaaatga tgatattgtc       540
     ctggcagttg aacgtgaact tatgggtaaa aaacttgcag gcaagaaaat agtgctgaca       600
     tccggtgcaa ctgctgaagc tattgatcct atccgtataa tcacaaacag ggcttccggt       660
     aaaacaggtc aggaattggc cagggaggct ttccggcggg ggggagatgt tacaataatc       720
     cacaggaatg aactggatgc ggatggtata aatgaggttt atgcagaaag tgcagccagt       780
     atgctggata gttgcatgga agaaataggc aggggttgtg atgtattcat aagttcggct       840
     gcgatttcgg attatacact tgattctttg gggtccaaaa taaaatcagg ccagaagctt       900
     atcctcgaaa tgcatcccac tgaaaagatt ttgccacagg taagaagtaa ttatcctgca       960
     atagtgactg tgggatttaa agctgaaact ggtgttggtg aaaaagagct tgtgggaagt      1020
     gcgacccgta tgcttgaaga atacggcctt gatatggtcg ttgccaatga tgtgatggca      1080
     ggtggaatgg gcacctctga aaattccata tatatcctgc aggatgaatc gtcagcatct      1140
     cattatagtg gttccaaacg ttatcttgca tctataataa tggaccgggt tgagcaaatc      1200
     ctgttgtga                                                              1209
//

If you have problems or comments...

PBIL Back to PBIL home page