(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE505

CP001994.PE505       Location/Qualifiers
FT   CDS_pept        532813..533688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0516"
FT                   /product="pantothenate kinase"
FT                   /EC_number="2.7.1.33"
FT                   /note="COGs: COG1829 kinase (sugar kinase superfamily);
FT                   InterPro IPR006204; PFAM: GHMP kinase; SPTR: Q8PUQ0
FT                   Conserved protein; PFAM: GHMP kinases N terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ADE36043"
FT                   /db_xref="GOA:D5EA42"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR012043"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:D5EA42"
FT                   /protein_id="ADE36043.1"
FT                   /translation="MDPRQKCVTCFAPGHITGFFTIHDNDDPAFKGTTGCGIVLNRGVT
FT                   AKVCVGPDITGTEIFLNGSKKQASVTSHLVASLSCEPVRIESHADIPVGCGFGASGAGA
FT                   LAISYCLNDLFSLGLTQNEIVEAAHIAEVVGGGGLGDVEAQAYGGPVIRKRPAPITKGG
FT                   LLDRIVSPSFSVHCVVLGKLSTKTTLADSSVTGKINIAGKTAMKNLLQSPTIEEFMRQS
FT                   RSFSFELGLLSKGAEDIIEAVENVGGFASQAMLGDAVFAVAGPECTDTAIWEVMSEFGT
FT                   VFSSTVAGTD"
     atggatccaa gacaaaaatg tgtaacatgc tttgctcctg gccatatcac aggttttttc        60
     acaatccatg ataacgatga tccggccttt aagggcacta caggttgcgg tatagttctt       120
     aacagagggg tcactgcaaa agtatgtgtg ggtcctgata ttacagggac agagattttc       180
     ctgaatggtt caaagaagca agcatctgta acttcccatc tggttgcctc cctctcctgt       240
     gaacccgtaa ggatagaatc ccatgctgat atccctgttg gctgtggttt tggtgcttcc       300
     ggtgcaggtg cactggcaat ttcctattgc ttaaatgatc ttttctcatt gggcctgaca       360
     caaaatgaaa tcgtggaagc cgcccatatt gccgaagttg tagggggagg cgggctgggc       420
     gatgtggaag ctcaggcata cggtggacct gtcatcagga aaagacctgc tccgattaca       480
     aaaggaggcc tgctggatcg catcgtttct ccctctttta gtgtacactg tgtggttctg       540
     ggaaagttgt ctacaaaaac gacccttgcc gattcctctg tgactggaaa gatcaatatt       600
     gcaggcaaaa ccgcaatgaa aaacttgcta cagagtccga ccattgaaga atttatgcgc       660
     caatcccgca gttttagttt tgaactgggc cttttgagca agggtgcaga agatattata       720
     gaggctgtgg aaaatgtcgg tggctttgct tcacaggcta tgcttggaga tgcggttttt       780
     gcggttgctg gcccggagtg tacagatact gccatctggg aagtgatgag tgaattcgga       840
     acagtattta gcagcacggt tgcaggtact gattaa                                 876
//

If you have problems or comments...

PBIL Back to PBIL home page