(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE51

CP001994.PE51        Location/Qualifiers
FT   CDS_pept        56386..57606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0052"
FT                   /product="Nucleotidyl transferase"
FT                   /note="COGs: COG1208 Nucleoside-diphosphate-sugar
FT                   pyrophosphorylase involved in lipopolysaccharide
FT                   biosynthesis/translation initiation factor 2B gamma/epsilon
FT                   subunits (eIF-2Bgamma/eIF-2Bepsilon); InterPro
FT                   IPR001451:IPR005835; KEGG: similar to mannose-1-phosphate
FT                   guanylyltransferase; PFAM: Nucleotidyl transferase;
FT                   transferase hexapeptide repeat containing protein; SPTR:
FT                   Q12TM8 Nucleotidyl transferase; PFAM: Nucleotidyl
FT                   transferase; TIGRFAM: glucose-1-phosphate
FT                   thymidylylransferase, long form"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35589"
FT                   /db_xref="GOA:D5E8T0"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR023915"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D5E8T0"
FT                   /protein_id="ADE35589.1"
FT                   /translation="MKAIVLAAGEGVRCAPLTNTRSKVMLPVANRPILEYVISALVDNG
FT                   IEDVVLVVGYEKEKVMNYFGDGNDFGARITYVDQTSQLGTAHAISQAIPALGNDNESFL
FT                   VLNGDNIIEKETINKLITNHAGDATVLTTPREKVCGYGVVMSAAGKVKGIFEKPTRQIS
FT                   HMVNTGIYAFNRDIIAEIDKTEISERGEYEITHTLQNMVKKDRDVRVIVTKNLWMDSVY
FT                   AWDLLDINARLLANCESNISDTSVVYESVTLVGDVEIGDDTVIRPGSYIVGPIKIGSNC
FT                   DIGPQVTVLPCTSIGDNVSLGPYTYIQNSILMDNVRVESHSHVSESIIGFYCNFGPYSI
FT                   CEADNDVNIEIENELVPVEKSGVVIGDDCKFGSRTLTEAGTLVGNNCTVRSGTNVDRHL
FT                   PANSTVL"
     atgaaagcaa tcgttcttgc tgcaggggag ggtgtaagat gtgctcccct cacaaatacc        60
     cgctcaaagg tcatgttacc ggtagccaat cgaccgatcc ttgaatacgt tatatccgcg       120
     cttgtggata acgggataga ggatgtagtg ctggttgtgg gttatgagaa ggagaaggta       180
     atgaactatt ttggagacgg caatgatttc ggggcaagaa ttacttatgt ggatcagacc       240
     tcacaactgg gtaccgctca tgctataagc caggccattc ctgcactggg aaatgataat       300
     gaatcgttcc tggtgctcaa tggggataac atcattgaaa aagagactat caataaacta       360
     atcacaaatc atgcagggga tgccactgta ctaaccactc cccgggagaa ggtatgtgga       420
     tatggagtgg tcatgagtgc tgcagggaag gtaaaaggca tctttgaaaa acccacacgc       480
     cagataagtc atatggtaaa taccggtatc tatgccttta accgggatat tattgcagaa       540
     atagataaga ctgagatctc cgagagaggg gaatacgaaa ttactcatac cctgcaaaac       600
     atggtgaaaa aggatcggga tgtcagggtt attgttacaa agaatctctg gatggattct       660
     gtatacgcct gggacctgct tgatatcaat gccagattgc tggcaaactg tgaatcaaac       720
     atcagtgata cttcggttgt ttatgagtcc gtgaccctgg taggtgatgt ggagataggg       780
     gatgatacgg tcatcaggcc cggttcttat atcgtaggtc cgataaagat cgggagcaac       840
     tgtgatattg gaccacaggt aacagtccta ccttgcacca gtatagggga taatgtgtct       900
     cttgggccct atacctatat ccagaacagt atccttatgg ataatgtgcg tgtagaatcc       960
     cacagtcatg tatccgagag tattataggg ttttactgta actttggtcc ctactccata      1020
     tgtgaagcgg ataacgatgt gaatatcgag atcgaaaatg aacttgtacc tgtggaaaag      1080
     agtggcgtgg ttatcgggga tgactgtaaa tttggatcaa ggacccttac cgaggcaggc      1140
     acccttgtgg gcaataactg tacagtgaga tcgggtacaa atgtggatag gcatctgcct      1200
     gcaaattcta cagtgctttg a                                                1221
//

If you have problems or comments...

PBIL Back to PBIL home page