(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE511

CP001994.PE511       Location/Qualifiers
FT   CDS_pept        539120..540319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0522"
FT                   /product="methionine adenosyltransferase"
FT                   /EC_number="2.5.1.6"
FT                   /note="COGs: COG0192 S-adenosylmethionine synthetase;
FT                   InterPro IPR002133; KEGG: dal:Dalk_2506 methionine
FT                   adenosyltransferase; PFAM: S-adenosylmethionine synthetase;
FT                   PRIAM: Methionine adenosyltransferase; SPTR: Q8CXS7
FT                   S-adenosylmethionine synthetase; TIGRFAM:
FT                   S-adenosylmethionine synthetase; PFAM: S-adenosylmethionine
FT                   synthetase, C-terminal domain; S-adenosylmethionine
FT                   synthetase, central domain; S-adenosylmethionine
FT                   synthetase, N-terminal domain; TIGRFAM:
FT                   S-adenosylmethionine synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ADE36049"
FT                   /db_xref="GOA:D5EA48"
FT                   /db_xref="InterPro:IPR002133"
FT                   /db_xref="InterPro:IPR022628"
FT                   /db_xref="InterPro:IPR022629"
FT                   /db_xref="InterPro:IPR022630"
FT                   /db_xref="InterPro:IPR022631"
FT                   /db_xref="InterPro:IPR022636"
FT                   /db_xref="UniProtKB/TrEMBL:D5EA48"
FT                   /protein_id="ADE36049.1"
FT                   /translation="MSKLKYDHVFTSESVGAGHPDKICDQVSDAVLDACLEFDPNSRVA
FT                   CETLVAHDLVVNAGEITCKGMEKIDTEKIAREVVRDIGYDHKDLLFWDKSFEYISKIHE
FT                   QSPDISMGVTEGTGLYEEQGAGDQGMMFGYATNETDEYMPAPIAYSHRLLRYLDSIRQE
FT                   GRVSYLRPDAKSQVSVKYVNGKPDHITAVVVSQQTDDIPLETVRNEMVGFINEVLEPTG
FT                   MLRSDTEYYINPTGAFVLGGPYADAGVTGRKIIVDTYGGVGSHGGGAFSGKDPSKVDRS
FT                   AAYYARYVAKNIVAAGLADKCEIQVAYAIGVSKPLSINVDTYGTGVIEDQEIQDVLESG
FT                   EIFDFRPAALIEDLNLLHPKGWSYRQASSYGHFGRNIFPWEQLDKVDSLKGKFNLNVVK
FT                   "
     atgagcaaac tcaaatatga ccatgtattt acttcagaat cggtcggtgc agggcatcca        60
     gataagatct gtgatcaggt atctgatgca gttctggatg catgcctgga atttgatcct       120
     aacagtcgtg tggcatgtga aacacttgta gcccatgacc ttgtggtaaa tgcaggtgaa       180
     attacctgta agggtatgga aaagattgat acagagaaaa tagcacgtga agttgttcgt       240
     gatataggat atgatcataa ggaccttctt ttctgggaca aatcctttga atacatatca       300
     aagatccatg aacaatctcc tgatatatca atgggagtta cagagggtac ggggctatat       360
     gaagagcagg gtgcagggga ccagggtatg atgtttggtt atgctaccaa tgaaacagat       420
     gaatacatgc ctgctccaat tgcgtatagt cacaggctcc tcaggtatct ggactctatc       480
     cgtcaggaag gtagggtatc ctacttaagg ccggatgcca aatcacaggt ttcagtgaaa       540
     tatgtaaatg gaaaacctga ccacataaca gctgtagtgg tttcacagca aactgatgac       600
     atcccacttg aaacagttcg taatgaaatg gtaggattta tcaatgaagt ccttgagcca       660
     accggtatgt tgaggtcaga taccgagtat tacataaacc caaccggcgc attcgtcctg       720
     ggaggtccct atgcggatgc aggagttacc ggacgtaaga tcatcgtgga tacctatgga       780
     ggagtaggca gccatggagg gggagctttc tcgggtaagg atccatccaa ggttgatcgt       840
     tcagcagcat actatgcaag atatgtcgcc aaaaacatag ttgcagcagg tcttgccgat       900
     aaatgtgaaa tccaggtggc ctatgccatt ggtgtctcaa agcctctcag tatcaatgtt       960
     gatacctatg gtacaggtgt aatagaagac caggaaatcc aggatgtact ggaatccggt      1020
     gaaatatttg atttccgacc ggcagccttg atagaagatc tgaatttgtt gcatcctaaa      1080
     ggttggtcat acaggcaggc atcttcttat ggtcattttg gcaggaatat tttcccatgg      1140
     gaacaacttg acaaggttga tagcctcaaa ggaaaattca atctcaacgt cgtgaaatga      1200
//

If you have problems or comments...

PBIL Back to PBIL home page