(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE515

CP001994.PE515       Location/Qualifiers
FT   CDS_pept        543728..544663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0526"
FT                   /product="Adenosine kinase"
FT                   /EC_number="2.7.1.20"
FT                   /note="COGs: COG0524 Sugar kinase ribokinase family;
FT                   InterPro IPR011611:IPR002173; KEGG: noc:Noc_2548
FT                   carbohydrate kinase, PfkB; PFAM: PfkB domain protein;
FT                   PRIAM: Adenosine kinase; SPTR: A2WCU5 Sugar kinase; PFAM:
FT                   pfkB family carbohydrate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ADE36053"
FT                   /db_xref="GOA:D5EA52"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:D5EA52"
FT                   /protein_id="ADE36053.1"
FT                   /translation="MDKALICGSFAFDNIMVFNDQFKNHILPDKVHILNVSFLVPELRR
FT                   EFGGCAGNIAYNLKLLGGDPLPMGTVGTDFEHYAKWMDEKGINREYVNVVNDTFTAQAF
FT                   ITTDMDDNQITAFHPGAMDYSHNYSVLDVNDPVVGIVAPDGREGMLQHASEFAEAKIPF
FT                   IFDPGQGLPMFNGDELMEFIKQATWLTVNDYEWQLIKERTGKSQEEIATYLDALIITKG
FT                   PEGSLIYSNDEIIQIPAAKPNVLKDPTGCGDAYRAGLLYGLINDMDWDTTGRIASLMGA
FT                   IKIEYQGTQNHHFKLADFKRRFKESFGTVF"
     atggataaag ctttaatttg tggatcgttt gcttttgata atatcatggt atttaatgac        60
     cagttcaaga atcatatttt gccggataaa gtgcatatat taaatgtgtc attcctcgtt       120
     cctgaattgc gtcgtgaatt tggtggttgt gcgggaaata tagcctataa tctcaagtta       180
     cttggtggcg atcccctccc aatggggacg gttggtacag attttgagca ttatgcaaaa       240
     tggatggatg aaaagggtat caatcgggaa tatgtgaatg tggtaaatga tacatttaca       300
     gcacaagctt tcattacaac agatatggat gacaaccaga taactgcctt ccatcccggg       360
     gcaatggatt attcccataa ttattcagta cttgatgtaa atgatcctgt agtgggcatt       420
     gtagcaccgg atggaaggga agggatgctt caacacgcct ctgaatttgc cgaagctaaa       480
     atcccattca tattcgatcc gggtcaggga cttcccatgt tcaatggaga tgaactgatg       540
     gaattcatta aacaggcgac ctggcttaca gttaatgatt atgagtggca actgataaag       600
     gagcgcaccg gtaagagtca ggaagaaatt gctacatatc tggatgctct aataatcaca       660
     aaaggtccag agggttcgtt gatatatagc aacgatgaaa taattcaaat ccctgctgcc       720
     aaacccaatg tattgaaaga tcccactggt tgtggggatg catatcgtgc aggtttgctt       780
     tatggtttaa taaatgatat ggactgggat actacaggaa ggattgcctc tcttatgggc       840
     gctataaaaa tagagtatca aggtacccag aaccatcatt ttaagctagc agatttcaag       900
     aggcgtttca aggaatcctt tggtacggtc ttttaa                                 936
//

If you have problems or comments...

PBIL Back to PBIL home page