(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE517

CP001994.PE517       Location/Qualifiers
FT   CDS_pept        546616..546852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0528"
FT                   /product="DNA-directed RNA polymerase, subunit H"
FT                   /EC_number="2.7.7.6"
FT                   /note="COGs: COG2012 DNA-directed RNA polymerase subunit H
FT                   RpoH/RPB5; InterPro IPR000783; KEGG: RNA polymerase Rpb5,
FT                   N-terminal domain containing protein; K03013 DNA-directed
FT                   RNA polymerase II subunit E; PFAM: RNA polymerase Rpb5;
FT                   SPTR: Q12WS3 DNA-directed RNA polymerase subunit H; PFAM:
FT                   RNA polymerase Rpb5, C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ADE36055"
FT                   /db_xref="GOA:D5EA54"
FT                   /db_xref="InterPro:IPR000783"
FT                   /db_xref="InterPro:IPR020609"
FT                   /db_xref="InterPro:IPR035913"
FT                   /db_xref="InterPro:IPR039531"
FT                   /db_xref="UniProtKB/TrEMBL:D5EA54"
FT                   /protein_id="ADE36055.1"
FT                   /translation="MSKFSLLDHEFIPRHEIIDEDEIKSVLKKYNIGREQLPKIKIEDP
FT                   VIKEIGAEVGDIVKITRKSQTAGEALYYRYVIE"
     ttgagtaagt tcagcctgct tgatcatgaa ttcattcccc gtcatgaaat tattgatgag        60
     gatgaaataa aatctgttct taagaagtat aacattggta gggaacagct acctaaaatc       120
     aagatagaag atcctgttat taaagaaatc ggtgctgaag tgggagatat agtaaaaatt       180
     acccgcaaga gccagactgc aggagaggcc ctttattacc ggtatgtaat tgaatga          237
//

If you have problems or comments...

PBIL Back to PBIL home page