(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE518

CP001994.PE518       Location/Qualifiers
FT   CDS_pept        546980..548617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0529"
FT                   /product="DNA-directed RNA polymerase, subunit B'"
FT                   /EC_number="2.7.7.6"
FT                   /note="COGs: COG0085 DNA-directed RNA polymerase beta
FT                   subunit/140 kD subunit; InterPro
FT                   IPR007642:IPR007645:IPR007644; KEGG: NRPB2; NRPB2 (EMBRYO
FT                   DEFECTIVE 1989); DNA binding; K03010 DNA-directed RNA
FT                   polymerase II subunit B; PFAM: RNA polymerase beta subunit;
FT                   RNA polymerase Rpb2 domain 3; RNA polymerase Rpb2 domain 2;
FT                   SPTR: Q12WS4 DNA-directed RNA polymerase, subunit B'; PFAM:
FT                   RNA polymerase Rpb2, domain 3; RNA polymerase Rpb2, domain
FT                   2; RNA polymerase beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ADE36056"
FT                   /db_xref="GOA:D5EA55"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="UniProtKB/TrEMBL:D5EA55"
FT                   /protein_id="ADE36056.1"
FT                   /translation="MDTSFLSEAYFTRDKIVQHHIDSYNKFLSSGLQKVIDEQHLIETD
FT                   IEDIYVKLGRIRVEKPVVKEADGAIENLYPNEARLRNLSYSAPLFLEMSVVKGGEESEP
FT                   REAKIGQLPVMIKSEICNLVGIDDEDMIEHGEDPLDPGGYFIVNGTERVVMTLEDLAPN
FT                   KILAEIGERYGDRIEVSKVFSQRRGYRALVVVERGRKALLEVSFPSISGRINFITLLRA
FT                   LGIETDEDVVKTVSTDPEIMKFMFENLEESEVDTVEEAVEKIGMRVASGQASEYQVKRA
FT                   NYVIDRYLLPHLGNEPEDRVAKAHFLGRMAESCFELALGRRSADDKDHYSNKRLKLTGD
FT                   LLEDLFRVAFNRLTRDVKYQLERANMRNRELNVSTLVRADVLTDRLQHPLATGNWVGGR
FT                   SGVSQLLDRTDYISTLSHLRRVISPLSRAQPHFEARDLHSTQWGRLCPSETPEGPNCGL
FT                   VKNFAQMVELSTGANDFDKVKNVLYGLGVAPAQLHVPEKILKYSNELGTDTEEHEMPVD
FT                   DLIKSPGYQDITDDSDKKPLGNGGILGD"
     ttggatacca gttttctgtc ggaagcctat tttacaaggg ataaaatcgt acaacaccat        60
     atcgattcat ataacaagtt cttaagcagc ggtcttcaga aagttatcga tgaacaacat       120
     ctcatcgaga ctgacattga ggatatatac gtcaagttag gccgcatcag agttgaaaaa       180
     ccggttgtca aggaggcaga tggtgcaatt gaaaacctct accccaatga ggccagactc       240
     cgtaaccttt cctattctgc tccgcttttc ctcgaaatgt ccgtggtcaa aggtggagaa       300
     gaatccgaac caagggaagc caaaattgga caactgccag ttatgatcaa atctgagata       360
     tgtaatcttg ttggaatcga tgatgaggat atgatcgaac acggcgagga tccgcttgat       420
     cccgggggct actttatcgt taatggtacc gaaagggtag ttatgaccct tgaggatctt       480
     gcacccaaca agatactggc cgaaatcgga gagcgttacg gggatcgcat agaagtctca       540
     aaggttttct cccagaggag gggctacagg gcacttgtgg tagttgaaag gggcaggaaa       600
     gccctgctgg aagtttcttt cccctctatt tccggaagga taaatttcat aactcttctc       660
     cgggctcttg gtattgaaac tgatgaggat gtcgtcaaga cggtttcaac agatccggaa       720
     attatgaagt tcatgttcga aaacctcgaa gagtcggaag tcgatacagt agaagaagcg       780
     gttgagaaga tcggtatgag ggtggcctcc ggtcaggcaa gcgagtatca ggtcaagagg       840
     gcaaattatg ttattgacag gtatctgctt cctcatcttg gtaatgaacc agaggacagg       900
     gttgcaaaag ctcatttcct gggtcgtatg gccgaatcat gttttgaact ggctcttggg       960
     cgtcgtagtg ctgacgataa ggatcactat tccaacaagc gcctgaaact aacaggtgac      1020
     ttgctggaag atctcttcag ggtggccttc aaccgcctga cacgtgatgt caaataccag      1080
     cttgaaaggg caaatatgag gaacagggaa ctgaatgttt ccacactggt cagggcagat      1140
     gtccttacag accgtctcca gcacccactt gcaacaggta attgggttgg aggaagaagt      1200
     ggtgtatccc agttgcttga tcgcactgat tacatttcta cactttccca cctgagacga      1260
     gtaatatctc ctctctccag ggcacaacct cactttgaag cccgtgattt gcactctact      1320
     cagtggggca gattgtgtcc ttcagaaaca ccagaaggtc ccaactgtgg tttggtgaaa      1380
     aattttgccc agatggtgga actctccaca ggggcgaatg atttcgataa agtgaaaaac      1440
     gttctttatg gtcttggtgt ggcaccggct cagcttcatg tgcctgaaaa gatccttaag      1500
     tattccaatg aactaggaac tgatacagag gaacatgaaa tgccagtaga tgatttgatc      1560
     aaatctccgg gttatcagga tattactgat gatagtgata agaaacctct cggtaatggg      1620
     ggcattcttg gtgactga                                                    1638
//

If you have problems or comments...

PBIL Back to PBIL home page