(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE52

CP001994.PE52        Location/Qualifiers
FT   CDS_pept        57616..59436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0053"
FT                   /product="glutamine--fructose-6-phosphate transaminase"
FT                   /EC_number="2.6.1.16"
FT                   /note="COGs: COG0449 Glucosamine 6-phosphate synthetase
FT                   contains amidotransferase and phosphosugar isomerase
FT                   domains; InterPro IPR001347:IPR000583:IPR005855; KEGG:
FT                   gbm:Gbem_0090 glucosamine--fructose-6-phosphate
FT                   aminotransferase, isomerizing; PFAM: sugar isomerase (SIS);
FT                   glutamine amidotransferase class-II; SPTR: Q12TM9
FT                   Glutamine--fructose-6-phosphate transaminase; TIGRFAM:
FT                   glucosamine/fructose-6-phosphate aminotransferase,
FT                   isomerizing; PFAM: SIS domain; Glutamine amidotransferases
FT                   class-II; TIGRFAM: glucosamine--fructose-6-phosphate
FT                   aminotransferase (isomerizing)"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35590"
FT                   /db_xref="GOA:D5E8T1"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005855"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="InterPro:IPR035490"
FT                   /db_xref="UniProtKB/TrEMBL:D5E8T1"
FT                   /protein_id="ADE35590.1"
FT                   /translation="MCGIVGYVGKTGASSVIMDCLRRLEYRGYDSAGLSVLNGDLQTYK
FT                   AAGSISELDKVLPAEIKGNIGIGHTRWATHGMPNDVNAHPHCSSDIVVVHNGIIENYLK
FT                   LKEWLEDEGYEFVSDTDTEVIAHLVHFNSNSLDLFEAVHKSMAVLEGSYAIAVMSKNNP
FT                   DTLIASRKDSPLIVGLGENEFFTSSDATAFVAHTRDVIFVDDREIVKLTPEKVEFYDME
FT                   GQLLEKQISTIDWDVEAAEKSGYAHFMLKEIHEQTRSLQKTFAGKLAELEGNVRLTELK
FT                   LTDEQIRNINRVEIIACGTSWNAGLFGKYLLETLAGMHTDVSAASEFRYRDPVMDENVL
FT                   TIAITQSGETADTLAAIRNVVQYESSTIAITNVVGSTITREAENVVYTHAGPEIGVAAT
FT                   KTFTAQLIALYLLAIYMGRKRNYLLPDEAKDVIKALKELPGHVQQVLNQRDQIRKNAAQ
FT                   YADCRDYYFIGRGLNYPAALEAALKLKEISYIHAEGYAAGELKHGPLALLEKGTPVVAI
FT                   VTKNRTYAKMLSNIKEVKARGAEVIAVADERDREIGKYADLVIFVPATNPLLSPVLSSV
FT                   ALQLLAYYTALEKGCEIDKPRNLAKSVTVE"
     atgtgtggaa tcgtaggtta tgtgggaaaa accggtgctt catcggtgat catggattgc        60
     ctgcgccggc tggagtatag gggttatgat tctgccgggt tgagtgtctt aaacggtgat       120
     ctgcagacct ataaggccgc cggcagtatc agtgaacttg ataaagtgct acctgcagag       180
     atcaaaggca atattggaat cgggcataca cgctgggcca cacatgggat gcccaatgat       240
     gtgaacgccc atccacactg ttcctcggat atcgtggtag tgcataacgg gataattgag       300
     aattatctca aacttaaaga atggttggaa gacgaaggtt atgaatttgt atcggatact       360
     gataccgaag tgattgctca tctggtgcat tttaacagta attccctgga cctgttcgag       420
     gcagtgcaca aaagtatggc agtgctggaa ggctcctatg cgatcgcggt tatgagtaag       480
     aataatccgg ataccctgat cgcttccagg aaggacagtc ccttgatagt gggtctgggg       540
     gagaatgaat ttttcacttc ctctgatgcc acggcttttg tggctcatac acgtgatgtt       600
     atttttgtgg atgacaggga aatcgtgaaa ctgactcctg agaaggtgga gttctatgat       660
     atggaaggcc aattgctgga aaagcaaatt tccacgatcg actgggatgt ggaggcggca       720
     gaaaagagtg ggtatgccca tttcatgctc aaagagatcc atgagcagac acgttccctc       780
     cagaagacct ttgcaggcaa attggctgag ctggaaggta atgtccggtt aactgaactg       840
     aaacttacgg atgaacagat aagaaatata aacagggtgg aaataatcgc ctgtggcaca       900
     tcctggaatg cgggattgtt cggtaaatac ctgctggaaa ctctggcagg gatgcatacc       960
     gatgtcagtg ccgcctctga gtttcggtac cgggatccgg tgatggatga aaatgttctc      1020
     actattgcaa tcacccagtc aggggagacg gcagataccc tggctgcgat caggaatgtg      1080
     gtacagtatg aatcaagtac catcgcgata accaatgttg tgggtagcac cattacgagg      1140
     gaggcggaga atgtagtgta tacccatgcc ggacctgaga ttggtgtggc tgcgaccaag      1200
     accttcacgg ctcagttgat cgctctctat cttctggcaa tctatatggg cagaaaacgt      1260
     aactatctcc tgcctgacga ggcgaaggat gtcatcaagg cactcaaaga attacccgga      1320
     catgtacagc aagtactgaa ccagagggat cagatccgca aaaatgcagc acagtatgct      1380
     gattgtcggg actattattt cattggcaga ggtctcaatt acccggcggc cctggaagcg      1440
     gctttgaaac tcaaggaaat atcctatatt catgctgaag ggtatgctgc gggcgaactg      1500
     aaacacggac ccctagcttt attggagaaa ggcacgccag ttgtggctat cgttacaaaa      1560
     aatcgtacct atgcgaagat gctgagtaat atcaaggagg tcaaggcacg tggggccgag      1620
     gttattgcag tggccgatga aagggatcgg gagataggca agtatgcaga tcttgtaatt      1680
     ttcgtacctg ccaccaatcc cctgctatca cctgtcctgt cctcggtggc tctgcagctg      1740
     cttgcctatt ataccgccct ggaaaaggga tgcgagatag ataaaccgcg caatcttgcc      1800
     aaaagtgtga ctgtggaatg a                                                1821
//

If you have problems or comments...

PBIL Back to PBIL home page