(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE523

CP001994.PE523       Location/Qualifiers
FT   CDS_pept        554621..555046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0534"
FT                   /product="NusA family KH domain protein"
FT                   /note="COGs: COG0195 Transcription elongation factor;
FT                   InterPro IPR004044:IPR010212; KEGG: nam:NAMH_0269
FT                   transcription termination factor NusA; PFAM: KH type 2
FT                   domain protein; SPTR: Q12WS9 NusA anti-termination factor;
FT                   TIGRFAM: NusA family KH domain protein; PFAM: KH domain;
FT                   TIGRFAM: NusA family KH domain protein, archaeal"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ADE36061"
FT                   /db_xref="GOA:D5EA60"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR010212"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR030842"
FT                   /db_xref="UniProtKB/TrEMBL:D5EA60"
FT                   /protein_id="ADE36061.1"
FT                   /translation="MSDIKLSTDAIRYIALFESMTGAPIKDCLIDDDRIICVVNNGDMG
FT                   AAIGKHGDNINRFKKAVDKHVDLIEYSDDPITFIKNAFGTIPTKSVEISDKNGKKVAYV
FT                   EVSSMNKGLAIGKSGRNIDKIKRIVNRHHDIEDLILQ"
     ttgagtgata tcaaactttc aacagatgct atcagatata tagccttgtt tgaaagtatg        60
     accggggcac ccattaagga ttgtcttata gacgatgatc gaattatctg cgtggtcaac       120
     aatggcgata tgggtgctgc aatcgggaag catggagata atattaaccg cttcaaaaaa       180
     gcagtcgaca agcacgtgga tttgattgag tattccgatg atccgataac cttcatcaag       240
     aacgcatttg gcacgattcc tacaaaatct gtagaaatca gcgacaaaaa cggcaaaaaa       300
     gttgcctatg ttgaggtttc cagtatgaat aaaggtctgg ccatcgggaa aagcggtcga       360
     aatattgata agataaaaag gattgtaaac cgtcatcatg atatcgaaga tttaatatta       420
     caataa                                                                  426
//

If you have problems or comments...

PBIL Back to PBIL home page