(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE53

CP001994.PE53        Location/Qualifiers
FT   CDS_pept        59450..60745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0054"
FT                   /product="Phosphoglucosamine mutase"
FT                   /EC_number="5.4.2.10"
FT                   /note="COGs: COG1109 Phosphomannomutase;
FT                   InterProIPR005841:IPR005844:IPR005846:IPR005843:IPR
FT                   005845:IPR016066; KEGG: cla:Cla_1567
FT                   phosphoglucomutase/phosphomannomutase family protein; PFAM:
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain I; phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain III;
FT                   phosphoglucomutase/phosphomannomutase;
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain II; PRIAM: Phosphoglucosamine mutase; SPTR: Q46AY7
FT                   Probable phosphoglucosamine mutase; PFAM:
FT                   Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha
FT                   domain II; Phosphoglucomutase/phosphomannomutase,
FT                   alpha/beta/alpha domain III;
FT                   Phosphoglucomutase/phosphomannomutase, C-terminal domain;
FT                   Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha
FT                   domain I"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35591"
FT                   /db_xref="GOA:D5E8T2"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR024086"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:D5E8T2"
FT                   /protein_id="ADE35591.1"
FT                   /translation="MKLFGSSGIRGLANKVIGPELALNVGMAVGTMADSVVIGKDPRIA
FT                   ADMIEQALIAGLSATGCEVTLGGLMSTPTLAFATVDYDCGIMITASHNPAEDVGIKLWN
FT                   PDGMAFDSQQQKRIEHIIENNEYATVTWNEVGNVKYEEGFVKRHCNAILSRMQPSHKRV
FT                   VVDCGCGAGCTITPYLLRQLGCEVISLNCQPDGYFPARNCEPAEKNLGQLIKAVRAFEA
FT                   DIGIAHDGDADRMMVVDEQGNFVSGDELLALFALQQKQDKVVVPVDTSMIVDDALGDTK
FT                   VLRCRVGDVYVAEQIKASGAYFGGEPSGSWIFPDVSYCPDGIYAAARIVGMIENSSLSK
FT                   MVVDLPHYTTLRDTIECAEDRKEAAMQRIKQSLEMMGNVTTIDGIRVDMENGWVLVRPS
FT                   GTEPKIRITAEAREDVDELFDKVMRIARGAIQ"
     ttgaaacttt tcggatcatc gggaatcagg gggctggcca ataaggtaat cggtcccgaa        60
     ctggcgttga atgtgggtat ggccgtgggt acaatggccg attcggttgt gatcggtaag       120
     gatccacgta tcgctgcgga tatgatcgag caggctctga ttgcaggcct gtctgctact       180
     ggctgtgagg ttacgctggg gggacttatg agtacgccca cactggcctt tgccactgtg       240
     gattatgatt gtgggattat gatcacggct tcacataacc ctgcagagga cgtggggatc       300
     aagttatgga atcccgatgg tatggctttt gattcgcagc aacaaaaacg gattgaacat       360
     attattgaaa ataacgagta tgcaaccgtc acgtggaatg aagtggggaa tgtgaagtat       420
     gaggaaggct ttgttaagcg gcattgcaat gccattttaa gcagaatgca accaagtcat       480
     aaacgtgtgg ttgtggattg tggttgcggt gctggatgta cgattactcc ttatttactc       540
     aggcaactgg gatgtgaggt aatttcattg aactgccagc cggatgggta ttttccggca       600
     cgcaattgcg aaccagcgga aaaaaatctg ggtcaactta tcaaggctgt cagggcgttt       660
     gaggcggata tcgggattgc ccatgatggg gatgcggatc ggatgatggt cgtggatgag       720
     cagggtaact ttgtctccgg ggatgaattg cttgccctgt ttgccctgca gcagaagcag       780
     gataaagttg tggtgcctgt ggatacttcc atgatagtgg atgacgcgct tggggatacc       840
     aaagtcctgc gctgcagggt tggggatgtc tatgtggcag agcagatcaa agcttcaggt       900
     gcttattttg gaggcgaacc ttcaggcagc tggatcttcc cggatgtatc gtattgtccc       960
     gatggcatct atgcagcagc ccggattgta ggaatgattg aaaacagctc tttatcaaag      1020
     atggttgttg atctgcctca ctataccacc ctcagagata caatcgaatg tgctgaagac      1080
     aggaaggaag ctgcaatgca gcgaatcaaa cagtccctgg aaatgatggg aaatgttact      1140
     accatagatg gtatacgggt ggatatggaa aacggctggg tgcttgtgcg tccctccggt      1200
     accgaaccga aaattcgtat cactgctgag gcccgggagg atgtggatga attgtttgat      1260
     aaagttatgc gtattgcaag gggtgcaata cagtga                                1296
//

If you have problems or comments...

PBIL Back to PBIL home page