(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE55

CP001994.PE55        Location/Qualifiers
FT   CDS_pept        complement(62203..63648)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0056"
FT                   /product="potassium uptake protein, TrkH family"
FT                   /note="COGs: COG0168 Trk-type K+ transport systems membrane
FT                   components; InterPro IPR003445:IPR004772; KEGG:
FT                   sat:SYN_02617 trk system potassium uptake protein; PFAM:
FT                   cation transporter; SPTR: Q12X31 K+ transporter Trk;
FT                   TIGRFAM: potassium uptake protein, TrkH family; PFAM:
FT                   Cation transport protein; TIGRFAM: potassium uptake
FT                   protein, TrkH family"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35593"
FT                   /db_xref="GOA:D5E8T4"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="InterPro:IPR004772"
FT                   /db_xref="UniProtKB/TrEMBL:D5E8T4"
FT                   /protein_id="ADE35593.1"
FT                   /translation="MSGLRINIVLGAIGSILWIIGGLMIIPFMVAVYYGESLFPFSLSL
FT                   TITLLIAFIFSLMLTEERGEWNMREGFMIVALGWLTAAIFSSMPYIFEGTPPINALFEA
FT                   MSGVTATGATALADIESYSKSLLFWRAMTQWVGGMGIILLFIVVLPKLGVAGRQMFRAE
FT                   VPGLKEEQLRPRIRETATLLWFVYVGLSIVEFILLYFAGLNAYDAITHTFTSISCAGFS
FT                   TYSDSIAAFNNTTVEGIFLIFMILGGANIALHYKTIFSDKTSLIKDEEFKFYLLIILIA
FT                   TLVLAYTLTRGEVYAIADSFRYSLFHVVSILTTTGYATTDFNMWPDSSRFILFLLMFIG
FT                   GCAGSTSGGIKVVRVLLLMKYADNVLFRTIHTKAIRPIRFNHRRIPEEIMHAIVSFLII
FT                   YFMIFIASATLLSLMGVDFVTTLSASIATLGNVGPGLGLVGPMANYGTLPDLGMLVLTA
FT                   NMWIGRLEVFTVMVLLTPAFWRH"
     atgagtggat taaggattaa tatagttctt ggcgccatcg ggtctatcct gtggataatt        60
     ggcggtttaa tgataatccc attcatggta gcagtttact acggtgaatc actctttcct       120
     ttttcccttt ccctgacaat caccctcttg attgcattta tattttcgtt gatgctaacg       180
     gaggaaaggg gcgaatggaa catgagagaa ggtttcatga ttgtagccct gggctggctt       240
     accgctgcaa tcttttcctc aatgccctac atctttgaag gtacaccccc gattaatgcc       300
     ctttttgaag ccatgtcagg agtaactgca accggagcta ctgctcttgc tgatattgaa       360
     agttatagta aaagcctcct gttctggaga gcaatgaccc aatgggtggg tggaatgggt       420
     atcattcttt tatttatagt agtactccca aaacttgggg ttgcaggacg gcagatgttt       480
     cgtgcagaag tccctggctt aaaagaagaa cagctgcgcc ccaggattag ggaaactgca       540
     actctgctct ggtttgttta tgtaggcctg tcaattgtcg aatttatctt actttacttt       600
     gcaggattga acgcttatga tgccataacc cataccttca cctccatatc atgtgccggc       660
     ttttcaacat attcagacag tatagcagcc tttaataaca ccaccgtaga aggtatcttc       720
     ttaattttca tgatccttgg cggagccaac attgctctgc attacaaaac catcttttct       780
     gataagacaa gcctgataaa agatgaagaa ttcaagttct atcttttaat cattctaatt       840
     gcaaccctgg tcctggcata taccctcacc agaggtgaag tatatgcaat tgctgattcc       900
     ttcagataca gtctcttcca tgttgtatcc atactgacaa ccacaggtta tgctaccacc       960
     gattttaaca tgtggcctga ctcatcccgt tttatcttat ttttgctgat gtttattggc      1020
     gggtgtgcag gttccacatc aggcggaatt aaagtagtac gtgtgctgct tctgatgaaa      1080
     tatgcagata atgtactgtt cagaacgatt cacacaaaag cgatcaggcc catacggttc      1140
     aatcatagaa gaattcccga agagattatg catgccattg tttctttttt gatcatatat      1200
     ttcatgatct ttattgcaag tgcaacactg ctttccctga tgggagttga ttttgtcacc      1260
     actctcagtg cttcaatcgc aaccctgggg aatgtcggac ccgggcttgg acttgtggga      1320
     cccatggcga attacggcac tcttcccgac ctcgggatgc tggttcttac agcaaacatg      1380
     tggataggca gacttgaagt atttacagta atggttctgc tgacacctgc tttctggaga      1440
     cattga                                                                 1446
//

If you have problems or comments...

PBIL Back to PBIL home page