(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE56

CP001994.PE56        Location/Qualifiers
FT   CDS_pept        63816..64058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0057"
FT                   /product="protein of unknown function DUF433"
FT                   /note="COGs: COG2442 conserved hypothetical protein;
FT                   InterPro IPR007367; KEGG: afr:AFE_1367 hypothetical
FT                   protein; PFAM: protein of unknown function DUF433; SPTR:
FT                   Q64C65 Putative uncharacterized protein; PFAM: Protein of
FT                   unknown function (DUF433)"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35594"
FT                   /db_xref="GOA:D5E8T5"
FT                   /db_xref="InterPro:IPR007367"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D5E8T5"
FT                   /protein_id="ADE35594.1"
FT                   /translation="MTFNDRITISHEICEGKPVIKGTRISVDFIIELLGNNWTHDDILE
FT                   NYPQLDKEDILAALKYASGILKSEHVYSIPPKATS"
     atgaccttca atgatagaat aaccataagt cacgaaattt gcgaaggcaa acctgtaatc        60
     aaagggacca ggatatcggt agattttata atagaacttc tgggaaataa ctggacccat       120
     gatgacattc tggaaaacta tcctcaactt gataaagagg atatacttgc agcattaaaa       180
     tatgcttcag gcatacttaa gagtgaacat gtatattcta ttcctccgaa ggcaacttct       240
     tga                                                                     243
//

If you have problems or comments...

PBIL Back to PBIL home page