(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE59

CP001994.PE59        Location/Qualifiers
FT   CDS_pept        complement(65314..65745)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0060"
FT                   /product="hypothetical protein"
FT                   /note="SPTR: Q46G91 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35597"
FT                   /db_xref="UniProtKB/TrEMBL:D5E8T8"
FT                   /protein_id="ADE35597.1"
FT                   /translation="MIIRFYKSQSERHIKDYQAFLITMEAPENNGFEIIPPEPRAGDNV
FT                   TIRGTSSAESVEIAMTFIRTVPVAGGKYKCRMPDTEVPERPNQLTVRAENVKDLKVRVK
FT                   ILLWMTRRARASDGVAEICESNVPSGKYDIRIEGNAADG"
     atgattatac gattctataa aagtcaatca gaaagacaca taaaggacta ccaggcattt        60
     ttaattacta tggaagctcc agagaacaat ggcttcgaga tcattccacc agaacccagg       120
     gccggagata atgtcaccat acgcgggaca tcttctgcag aatcagtaga aatagcaatg       180
     acctttatca ggaccgtgcc ggtggcgggt ggaaaataca aatgccgtat gcctgacaca       240
     gaagtaccag aaaggcccaa tcagttaaca gtgagagccg agaacgtgaa agatctgaag       300
     gtcagggtaa agatattgtt atggatgacc agacgtgcaa gggcttcaga cggtgtggcg       360
     gaaatctgcg aatccaatgt accttcaggc aaatatgata tccggattga aggtaatgct       420
     gcagatgggt ag                                                           432
//

If you have problems or comments...

PBIL Back to PBIL home page