(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE6

CP001994.PE6         Location/Qualifiers
FT   CDS_pept        5947..7650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0006"
FT                   /product="arginyl-tRNA synthetase"
FT                   /EC_number="6.1.1.19"
FT                   /note="COGs: COG0018 Arginyl-tRNA synthetase;
FT                   InterProIPR015945:IPR005148:IPR008909:IPR001412:IPR 001278;
FT                   KEGG: dvl:Dvul_1814 arginyl-tRNA synthetase; PFAM:
FT                   Arginyl-tRNA synthetase, class Ic, core; arginyl tRNA
FT                   synthetase domain protein; DALR anticodon binding domain
FT                   protein; PRIAM: Arginine--tRNA ligase; SPTR: Q12V97
FT                   Arginyl-tRNA synthetase; TIGRFAM: arginyl-tRNA synthetase;
FT                   PFAM: DALR anticodon binding domain; Arginyl tRNA
FT                   synthetase N terminal domain; tRNA synthetases class I (R);
FT                   TIGRFAM: arginyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35544"
FT                   /db_xref="GOA:D5E8N5"
FT                   /db_xref="InterPro:IPR001278"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR005148"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035684"
FT                   /db_xref="InterPro:IPR036695"
FT                   /db_xref="UniProtKB/TrEMBL:D5E8N5"
FT                   /protein_id="ADE35544.1"
FT                   /translation="MYLEFVNQVVSVLENAVQRAGFEPVEIAPEPSQHADLSTRVAFKL
FT                   AAVARKSPVEVANQIVENIQLRENCLIESIGTTGPYINIKANRTYIDRTFETVRSKKED
FT                   FGGNFYSGKILLEHTSANPNGPLHVGHIRNSIIGDTLTRILRKAGYDVDAQYYVNDMGR
FT                   QIAIVSWALEHFEMDPDLKSDHAIANVYIKANARLEEDSQKVEYIDNLMQRVESGDEEV
FT                   IKRFDDAVDLAVKGIRSTLLRMNVHHDSFVNESGFVRSGAVSDIVDKIRKTGRVDVDDG
FT                   ALVVDLSDYGFEKTLVVQRRDGTSLYTTRDLAYHEWKTMQADRIIDILGADHKLISGQL
FT                   KATLNAVGLKEPEIVIFEFVSLPEGSMSTRRGQFITADELLDKVQARAFEEVEKRRPEM
FT                   SPEFMEKVAGMVGIGAVRYDIIKVSPEKSTVFDWKAALDFEKQGGPFIQYSHARASSIL
FT                   KKAGEEGIWDPASKPNPSVLTDESEITLIKQIALFDKVLKQAADDLKPHIIAIYGRELA
FT                   DAFNQFYRFSPVLGAETEELRNARLGLVDCARIVLANVLETLGMGAPESM"
     ttgtatcttg aatttgttaa ccaggtagta tcggtactgg aaaatgccgt acaaagagcg        60
     ggatttgaac cagtggagat agcccccgaa ccttcccaac acgcagacct ctctacaagg       120
     gtcgctttca agctggccgc agttgccagg aaaagtccgg tggaagtagc aaaccagatc       180
     gtggaaaata tccagcttcg ggaaaactgt ctgatcgaaa gtatcgggac taccgggccc       240
     tacatcaata tcaaggccaa caggacctat attgaccgta cctttgagac tgtcaggagc       300
     aaaaaggaag attttggcgg aaatttttat tcaggaaaaa tattgctgga acacacttcg       360
     gccaatccca atggtcccct acatgtgggt cacatacgca attccataat aggagacacc       420
     ctgaccagga ttctgagaaa agccggatac gatgtggatg cccagtatta cgtgaatgat       480
     atgggcagac agattgccat agtttcctgg gccctggaac atttcgaaat ggaccctgat       540
     ctcaaatcgg atcatgctat tgccaatgta tatatcaagg ccaatgcccg gcttgaagag       600
     gactcccaga aggttgaata catcgataat ttgatgcagc gggtggaatc cggggatgag       660
     gaggtcataa aacgctttga tgatgccgtg gaccttgctg taaaaggaat tcgcagtacc       720
     ttacttcgta tgaatgtcca tcatgattct tttgttaatg aatcaggttt tgtccgttcg       780
     ggagctgtgt cggatatcgt ggataaaatc cgaaaaaccg gccgtgtcga tgtggatgat       840
     ggagctcttg tggtggatct ttccgattat ggatttgaaa agaccctggt tgtgcaacgc       900
     agggatggta cttcccttta tactacaagg gatcttgcct atcatgaatg gaaaaccatg       960
     caggcagatc ggattattga tattctggga gcggatcaca aattgatctc cggccagctc      1020
     aaagccactc tcaacgctgt gggcttaaag gagcctgaaa ttgtaatctt tgaatttgta      1080
     tccctgcccg agggttccat gagtacccga agaggtcagt tcataaccgc tgatgaattg      1140
     ctggacaagg ttcaagcaag agcctttgag gaagttgaaa aacgccgccc tgaaatgtca      1200
     cctgaattta tggaaaaagt ggccggtatg gtcggtatcg gtgctgtaag gtatgatata      1260
     atcaaggttt ctccggaaaa atccacggtc tttgactgga aagcagccct tgattttgaa      1320
     aaacagggtg ggccctttat acagtattct catgccaggg caagcagtat tctcaaaaag      1380
     gctggtgagg aaggaatatg ggatcctgca tcaaaaccca atccttcagt actgaccgat      1440
     gaatccgaga ttaccctgat aaaacaaatt gctctgtttg ataaggtatt gaaacaggct      1500
     gcagacgatc tcaaacctca cataatcgct atctatggga gggaattggc ggacgccttc      1560
     aaccagttct acaggttctc cccggtgctg ggtgccgaaa ctgaagaact caggaatgcc      1620
     agattgggtc ttgtggactg tgcccggata gtgctggcca atgtgctgga gaccttgggt      1680
     atgggtgctc cagaatcaat gtga                                             1704
//

If you have problems or comments...

PBIL Back to PBIL home page