(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE60

CP001994.PE60        Location/Qualifiers
FT   CDS_pept        complement(66089..66376)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0061"
FT                   /product="hypothetical protein"
FT                   /note="SPTR: Q8TI75 Predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35598"
FT                   /db_xref="UniProtKB/TrEMBL:D5E8T9"
FT                   /protein_id="ADE35598.1"
FT                   /translation="MATLTIPIDDEFYQKIQELSWIRWSRVVQEGIRKRKILEIYIRNN
FT                   TISESDASFCESIDWHPVDELPVKEEVVDKIKSEDKSSLVKVKDVADIFR"
     atggctacac taacaattcc tattgacgat gaattctatc aaaagataca ggaactttca        60
     tggatcagat ggtctagggt cgtgcaggaa gggatacgaa agcgcaagat actcgagatc       120
     tatatccgca acaataccat ctccgaatct gatgcctcct tttgcgaatc tatcgactgg       180
     catcccgttg acgaattgcc cgtcaaagaa gaggtcgttg ataagattaa atccgaagat       240
     aaaagttccc ttgtaaaggt caaagatgta gccgatatat tcaggtga                    288
//

If you have problems or comments...

PBIL Back to PBIL home page