(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE67

CP001994.PE67        Location/Qualifiers
FT   CDS_pept        71529..72827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0068"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mca:MCA2881 hypothetical protein; SPTR: B9ZHY8
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35605"
FT                   /db_xref="GOA:D5E8U6"
FT                   /db_xref="UniProtKB/TrEMBL:D5E8U6"
FT                   /protein_id="ADE35605.1"
FT                   /translation="MMDNRDDLVHILHDTRLNTVLSWIIVLVFIFLATVNFFEGRYTWT
FT                   ILIIFIVVVVLLPGLFFCKPSVMPSWLLLLLVLIPIAGNTTAYYFFLTRIPVYISVATL
FT                   SLLIVAEINWFTSVRMNPKFAIYLVIVTTLAVTGMWHFMRWVLDVMIGTTFLLDGRSVD
FT                   VINTAVMYEFIYALIAGIVAGVLFGWYFKTMMKKGTSDIIFPERIMDVSQEYTYSEPPK
FT                   VIRKLLGLSARKQKNITRFLQAFLVILFIFGVLSRDLHILLRAFLALIITFVPAFMKQR
FT                   HNLYLDPSLTLWITIAVFLDAIGTFWLYDNIARWDNLTHAVSSSTIAAAGYVIVRTIDI
FT                   YDSEINIPPRTMFVFIPLFILSVGVMWEILEFITDELALIIGIDAFLAQHGIHDTMGDM
FT                   LFNLIGAIVVALWGTFYLNNLSYKIAEMFETNK"
     atgatggata acagagatga tctggttcat attctacatg atactcgttt aaatactgtt        60
     ttatcctgga ttatcgtatt ggtatttata ttcctggcaa ctgtgaattt ttttgaaggg       120
     cgttatacat ggacaattct gattatcttt atagtagttg tcgttctttt gccaggatta       180
     tttttttgta agccatcggt aatgccatcc tggttactat tgcttctggt actgatccct       240
     attgctggaa atacaacagc ctattatttt ttccttacac ggattcctgt gtatatttca       300
     gttgctacgc tctcactttt aattgtagct gagataaact ggttcacgtc agtgcgaatg       360
     aatccaaagt ttgcaatcta tcttgtgata gttactacac ttgctgtcac cggtatgtgg       420
     catttcatga gatgggtact ggacgtaatg attggaacca catttctcct tgatggccgg       480
     tcggtggatg taatcaatac tgcagtgatg tatgaattca tttatgcact gattgctggt       540
     attgttgcag gtgttttgtt tggatggtat ttcaaaacca tgatgaaaaa aggaacttcc       600
     gacatcatat ttccagagag gattatggat gtatctcagg aatacacgta ttcagaacca       660
     ccgaaggtta tcaggaaact actggggtta tctgcccgga aacaaaagaa tataacaagg       720
     tttttgcagg catttcttgt aatattattc atatttggtg ttctctcaag ggacctgcat       780
     atattgctac gtgcattttt agcactgata attacttttg tgcctgcatt tatgaaacag       840
     agacacaatc tttatcttga tccatcccta actttgtgga taactattgc agtatttctt       900
     gatgctattg gtacattttg gctatatgat aacatcgcca gatgggacaa tctgacccat       960
     gccgtatctt caagtactat tgcagctgca ggatatgtaa ttgtaaggac tattgatatt      1020
     tatgattcgg aaattaatat ccctccaaga acgatgtttg tattcatccc cctgttcatc      1080
     ctttcagtag gtgtaatgtg ggagattctg gaattcataa ccgatgaatt ggcattgatt      1140
     attggaatag atgcttttct tgcacagcat ggtattcatg atacgatggg tgatatgcta      1200
     ttcaatttga taggagcaat tgtagtggct ttatggggca ccttctatct gaataacctg      1260
     tcatataaaa tcgcagaaat gtttgaaacc aataaataa                             1299
//

If you have problems or comments...

PBIL Back to PBIL home page