(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE75

CP001994.PE75        Location/Qualifiers
FT   CDS_pept        80299..80529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0077"
FT                   /product="hypothetical protein"
FT                   /note="SPTR: Q64BL8 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35613"
FT                   /db_xref="UniProtKB/TrEMBL:D5E8V4"
FT                   /protein_id="ADE35613.1"
FT                   /translation="MSTTICVDLQTKEKLRSLKKYPKESFNSVLERLTRMAIDEDELSD
FT                   EAIQNIEEALEDIKMGRTYSEYEVKKELGLL"
     atgtcaacta ctatctgtgt ggatttacaa acaaaagaaa aacttaggag tctaaaaaaa        60
     tatccaaaag aatcttttaa ttctgtactc gagagattaa ccagaatggc aatcgacgag       120
     gatgaactaa gtgatgaagc tattcaaaac attgaagaag ctttggaaga catcaaaatg       180
     ggtaggacct atagtgaata tgaggtcaag aaagagcttg gtttgttatg a                231
//

If you have problems or comments...

PBIL Back to PBIL home page