(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE79

CP001994.PE79        Location/Qualifiers
FT   CDS_pept        85866..87248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0081"
FT                   /product="mannose-1-phosphate guanylyltransferase (GDP);
FT                   mannose-6-phosphate isomerase, type 2"
FT                   /EC_number="2.7.7.22"
FT                   /EC_number="2.7.7.13"
FT                   /EC_number="5.3.1.8"
FT                   /note="COGs: COG0836 Mannose-1-phosphate
FT                   guanylyltransferase; InterPro
FT                   IPR013096:IPR005835:IPR001538:IPR006375; KEGG: tcx:Tcr_1678
FT                   mannose-1-phosphate guanylyltransferase/mannose-6-phosphate
FT                   isomerase; PFAM: mannose-6-phosphate isomerase type II;
FT                   Nucleotidyl transferase; Cupin 2 conserved barrel domain
FT                   protein; PRIAM: Mannose-1-phosphate guanylyltransferase;
FT                   SPTR: Q46FX9 Mannose-1-phosphate guanylyltransferase (GDP);
FT                   TIGRFAM: mannose-1-phosphate
FT                   guanylyltransferase/mannose-6-phosphate isomerase; PFAM:
FT                   Nucleotidyl transferase; Mannose-6-phosphate isomerase;
FT                   TIGRFAM: mannose-1-phosphate
FT                   guanylyltransferase/mannose-6-phosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35617"
FT                   /db_xref="GOA:D5E8V8"
FT                   /db_xref="InterPro:IPR001538"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR006375"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D5E8V8"
FT                   /protein_id="ADE35617.1"
FT                   /translation="MVNNMKSIILAGGSGTRLWPLSREHYPKQFLKIGEYSLFQQTFLR
FT                   CSEVSDVSEIFVVTNEDQKFYVIGQIQELGYDYPKENVLIEPEGKNTLPAICFGMKEIQ
FT                   ERFGESNAGIFSSDHVLDSRAMQTISEAKSLASRGYLLTFGIKPTSPNTGYGYIKPAEN
FT                   LGIGQKVSEFREKPDEETARRYIEESCLWNSGMFLFNTETFFSELAQCAPDIYESFEQN
FT                   EDINQIYAELPSISVDYGVMEKSQKVAVVPLQYKWSDLGNFAALYDELDKDSDENVVYD
FT                   CELLPLDSRQNLVHSRNGKLVSLIDVNDMIVVDTPDALLISPKESSQKVKQIVNQLKEK
FT                   NDPRAKIGQTVYRPWGSYTVLESSDNHVIKKIVVMPEQKLSLQLHYHRSEHWVVVTGMA
FT                   EVHVNGDDYFVRPGESTFIRAGERHRLGNPSKIPLEIIEVQLGEYVAEDDIVRFDDVYG
FT                   RQ"
     ttggtgaaca acatgaaatc catcattctt gcaggaggct ccggtacacg tctctggccg        60
     ctcagcagag agcattatcc gaaacagttc ttaaaaatcg gggaatattc cctcttccag       120
     cagactttcc tgcgctgcag tgaagtatct gatgtatcgg aaatattcgt ggttaccaat       180
     gaggaccaga aattctatgt cataggccag atacaggaat tgggatacga ttaccccaaa       240
     gagaatgtac tcatcgagcc tgaaggcaaa aataccctgc ctgcgatctg tttcgggatg       300
     aaggaaattc aggagaggtt cggggaatcc aatgcaggca ttttctcttc tgatcatgtg       360
     ctggattctc gggccatgca aaccatttca gaggcaaaat ccctggcatc ccggggttat       420
     cttttaactt ttggtatcaa accgacctct ccaaatacag gttatggcta cattaagcct       480
     gctgagaatc tgggtatcgg acaaaaagtc tccgagttca gggaaaaacc tgatgaagaa       540
     accgctcgcc ggtatattga ggaaagctgt ctctggaaca gtggcatgtt ccttttcaat       600
     acggaaactt ttttcagtga actggcacag tgtgcgcctg acatctacga atcatttgaa       660
     cagaatgaag atataaacca gatttatgca gagttacctt ccatatctgt ggactacggt       720
     gtcatggaaa aatcacagaa agtggccgta gttcccttgc aatacaagtg gagtgacctg       780
     ggcaattttg ccgctctcta tgatgaactg gataaggatt cagatgagaa tgtggtgtat       840
     gactgtgaac ttctgcccct tgattctcgg cagaatctgg tacattccag aaatgggaaa       900
     ctcgtctcct tgatcgatgt gaatgacatg atcgtcgtgg atactccgga tgccctgctc       960
     ataagtccta aagagagcag ccagaaggtc aagcagattg tgaatcaact caaggaaaag      1020
     aatgatccac gtgctaagat cggccagact gtgtatcggc cctggggttc ctatacagtc      1080
     cttgaatctt ccgataatca tgtgatcaag aaaatagtgg tcatgccaga gcaaaaactc      1140
     agtctccaat tgcattatca caggagtgag cactgggtgg ttgtaacagg catggctgaa      1200
     gtacatgtca atggcgacga ttattttgtc aggcctggtg aaagtacctt tattcgtgca      1260
     ggagaaagac acaggctggg caatcctagc aaaatccccc tggagataat tgaagtacag      1320
     ctgggagaat atgtggcaga ggatgatatc gtcaggtttg atgatgtgta tgggcggcag      1380
     taa                                                                    1383
//

If you have problems or comments...

PBIL Back to PBIL home page