(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE83

CP001994.PE83        Location/Qualifiers
FT   CDS_pept        90984..91775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0085"
FT                   /product="sulfotransferase"
FT                   /note="InterPro IPR000863; KEGG: sult5a1; sulfotransferase
FT                   family 5A, member 1; PFAM: sulfotransferase; SPTR: Q2KIG7
FT                   Sulfotransferase family, cytosolic, 2A,
FT                   dehydroepiandrosterone (DHEA)-preferring, member 1; PFAM:
FT                   Sulfotransferase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35621"
FT                   /db_xref="GOA:D5E8W2"
FT                   /db_xref="InterPro:IPR000863"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5E8W2"
FT                   /protein_id="ADE35621.1"
FT                   /translation="MTFYDISPIVIISHRRSGTHWSIDTIRNNLVGVGSEYYNLDRIQK
FT                   KNKYHLSIDEFMGNVEKCNGIPVLKSHMASDFTPFSGDEKQFVQDLLANSKIIYIYRDG
FT                   RDVLTSLYYYMAKFEPNLPSFSQFLKMKENFNSTYVNLNRVEYWNEHVSGWTKNDDFDV
FT                   CTISYEDLFYRYNKTVHILADFLNIPIAPDGVRKVDLQKPNLIEKIMNKMNVYSLPSSA
FT                   IAPRKGVVGDWMNCFSEEDLDFFNSIATELMVELNYYKQNR"
     atgacatttt atgatatatc accaattgtt attatttctc atagaaggtc tggaacacat        60
     tggtcaattg atacaattag gaataatttg gtcggtgtag ggtctgaata ctacaatctt       120
     gataggatac aaaaaaaaaa caaataccat ctttctatag atgaatttat gggcaatgta       180
     gaaaaatgca acggtatacc tgttttaaag tcacatatgg cttctgactt tactcctttt       240
     tcaggggatg aaaaacaatt cgttcaagac ttgttagcga attccaaaat aatttatata       300
     tatagggatg gaagggatgt actgacttca ctctactatt atatggcaaa atttgagcct       360
     aatttgcctt cattttctca gtttttaaaa atgaaagaaa acttcaattc aacttatgtt       420
     aatttaaaca gggttgagta ttggaatgaa catgtatcgg gttggacaaa aaacgatgac       480
     tttgatgtat gtaccatctc ttatgaagat ttattttata gatataataa aacagtacat       540
     atattggcag attttcttaa tattccaatt gctccagatg gtgttcgtaa agtggattta       600
     caaaaaccaa atcttattga aaaaattatg aacaaaatga atgtatattc tttgccttct       660
     tcagctatag cccctcgcaa aggagtagtt ggggattgga tgaattgttt ttcagaagaa       720
     gacttggatt ttttcaattc aatagcaaca gaattgatgg tcgaactaaa ttattataaa       780
     cagaataggt ga                                                           792
//

If you have problems or comments...

PBIL Back to PBIL home page