(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE84

CP001994.PE84        Location/Qualifiers
FT   CDS_pept        complement(91776..92351)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0086"
FT                   /product="methyltransferase FkbM family"
FT                   /note="InterPro IPR006342; KEGG: acp:A2cp1_0643
FT                   methyltransferase FkbM family; SPTR: C1EI90 Predicted
FT                   protein; TIGRFAM: methyltransferase FkbM family; TIGRFAM:
FT                   methyltransferase, FkbM family"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35622"
FT                   /db_xref="GOA:D5E8W3"
FT                   /db_xref="InterPro:IPR006342"
FT                   /db_xref="InterPro:IPR026913"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D5E8W3"
FT                   /protein_id="ADE35622.1"
FT                   /translation="MGFCPENIDSQSVIYSMGIGEDVSWDEALIARKNVTIHGFDPTPR
FT                   AIEYAKNRKLENFIVHPIGVSSKNGYMDFFTPINPSHVSHSLIKKNNTKYSIKVKIKSI
FT                   DSIMDELNHKKIDILKMDIEGSEYEVIPDMLEKKIFPHQLLIEFHHRFDSFTIKNTTDI
FT                   IDELIYYSYKISYISKNKQEFAFIRTTE"
     atggggtttt gtccagaaaa tatcgatagt caaagtgtga tttattctat gggcatagga        60
     gaagatgttt cttgggatga agctctcatt gcacgtaaga atgtaacaat tcatggattt       120
     gaccccaccc caagagcaat cgaatatgct aaaaatagaa aattagaaaa ttttatagtg       180
     catccaatag gagttagttc taaaaatggt tatatggatt ttttcacccc cataaaccca       240
     tctcatgttt cccactcttt aattaaaaaa aataatacaa aatatagcat taaagtaaaa       300
     ataaagagta tagactctat aatggatgaa ttaaatcata aaaaaatcga tattctaaaa       360
     atggatattg aaggatctga gtatgaagta atacccgata tgcttgaaaa aaaaatattc       420
     ccacatcaat tattaataga atttcatcat cgatttgatt cattcaccat taagaatact       480
     actgacatca ttgatgaatt aatttattat tcatacaaaa ttagttatat ttcaaaaaac       540
     aaacaagaat ttgcatttat aagaacaacg gaatga                                 576
//

If you have problems or comments...

PBIL Back to PBIL home page