(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE9

CP001994.PE9         Location/Qualifiers
FT   CDS_pept        9026..10048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0009"
FT                   /product="Methionine synthase II (cobalamin-independent)"
FT                   /note="COGs: COG0620 Methionine synthase II
FT                   (cobalamin-independent); KEGG: hypothetical protein
FT                   LOC760986; K00549
FT                   5-methyltetrahydropteroyltriglutamate--homocysteine
FT                   methyltransferase; SPTR: Q12V82
FT                   5-methyltetrahydropteroyltriglutamate--homocysteine
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35547"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/TrEMBL:D5E8N8"
FT                   /protein_id="ADE35547.1"
FT                   /translation="MTELIFDDIGSFPLQGGISAEWLREAIPAHEPAAFDVIRSTFRQK
FT                   LDAGVDVATYPQFQDMNKQFLSILNDPECIEGPFDVKTSCAKIVELEAIEKAAEEYQTE
FT                   TGIKPNVRVCVTGPLELYLQEFGGTSYDDILELFGQSIDKFVTNAIDNASNFNVHTVSI
FT                   DEPSIGINPQVMFDDDEIINALEKASATASRKGVDVEIHLHSPLYYELPCRTSGINVIG
FT                   VESAANPTYLELIDKNVLEETDSFLRAGVARTDIFNLVAILNEKYSTNAWQKPEMLQEL
FT                   VTDMETPSTILKRLEHAYGIFGDRVKYVGPDCGLGSWPTPEIASTLLGNVAEALDTFRN
FT                   "
     atgacagaac tgattttcga tgatatcggc agtttccctc ttcagggagg aataagtgca        60
     gagtggttaa gagaagcaat acccgcacac gaacctgcgg cttttgatgt catcagatcc       120
     acattccggc aaaaactgga tgccggtgtg gacgttgcaa cctatcctca gtttcaggat       180
     atgaataagc aattcctttc aattctcaat gatcctgaat gcatagaggg tccctttgac       240
     gtaaagacaa gttgtgcgaa gattgttgaa cttgaagcaa tcgaaaaagc tgcagaagag       300
     tatcaaacgg aaaccggtat aaaacccaat gtccgtgttt gtgtgacagg gccacttgaa       360
     ttatatttgc aggaattcgg tggaacttcc tatgatgata tactggaact ttttggacaa       420
     agcattgaca aatttgtgac caatgcaatc gataacgcct ccaatttcaa tgtgcatacc       480
     gtatccattg atgagcccag tattggtatc aaccctcagg ttatgtttga tgatgatgaa       540
     attataaatg cactggaaaa agcctctgca accgcttccc gcaagggagt agacgtagag       600
     atccatctgc actccccgct gtactacgaa ctcccctgtc gtacatcagg tatcaatgta       660
     attggtgtgg aatcagcagc caaccccacc tatctggaac ttattgataa aaatgtgctc       720
     gaggaaacgg attctttcct cagggccggt gtggcacgaa ctgatatttt caatcttgta       780
     gccattctca atgaaaaata ttcaaccaat gcctggcaga agcctgaaat gcttcaggaa       840
     ctggtaactg atatggaaac tccctctacc atactcaagc gtctggaaca tgcttatgga       900
     atattcgggg accgggtcaa atatgtcggg cctgattgtg gtctgggttc ctggccgacc       960
     ccggaaatag cttccaccct gcttggtaat gtagcagagg ctcttgatac tttcaggaat      1020
     tga                                                                    1023
//

If you have problems or comments...

PBIL Back to PBIL home page