(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE94

CP001994.PE94        Location/Qualifiers
FT   CDS_pept        complement(102337..103275)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0096"
FT                   /product="glycosyl transferase family 2"
FT                   /note="COGs: COG0463 Glycosyltransferase involved in cell
FT                   wall biogenesis; InterPro IPR001173; KEGG: amc:MADE_02590
FT                   glycosyl transferase, family 2; PFAM: glycosyl transferase
FT                   family 2; SPTR: A0YU19 Glycosyltransferase involved in cell
FT                   wall biogenesis-like protein; PFAM: Glycosyl transferase
FT                   family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35632"
FT                   /db_xref="GOA:D5E8X3"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D5E8X3"
FT                   /protein_id="ADE35632.1"
FT                   /translation="MKLVVMIPAYNEEDSIASVIKEIPRDCCDEVEVLVVSDGSTDNTA
FT                   EEAKKAGADRIVISKKNRGLAPTFKIGLQTALEMGADIIVNTDGDGQYNGNEIPKLIQP
FT                   VLDNKADLVLGSRTKGEIEYMPLHKKIGNRMATFITRHVSGLPVSDGQSGFRAFSRDCA
FT                   LRLNVMADYTYVQETLIQASYYDMAYTEVPIEFRKREGSSRLISNIFNYARRAGTTIAR
FT                   GYRDFHPLKTFSAIAGIFLLAGFVTGGRVLVNYFNTGAVGPYLPSAILTVLLFVIAILV
FT                   FIVALVADMLKTHRKIQDEMLYRLKKIELEE"
     atgaaattag tagtaatgat tcctgcatac aatgaagaag actcaatcgc ttcagtaatt        60
     aaagagatac ccagagattg ttgtgacgaa gttgaagtct tggtagttag tgatgggtcc       120
     acagacaata ctgccgagga agcaaaaaaa gcaggagcag atcgaatagt catttctaag       180
     aaaaacagag gtttagcccc tactttcaaa attggtttgc aaacagccct tgaaatgggc       240
     gcggatatta ttgtcaatac agacggtgat ggccaataca acggcaatga aattccaaag       300
     ctcatccagc cagttctgga caacaaagca gatttggttc tgggatccag aacgaagggt       360
     gaaattgaat atatgcctct tcataagaaa ataggcaaca gaatggctac tttcatcaca       420
     agacatgttt caggtcttcc ggtatctgat ggccaatccg ggttccgtgc attctcaaga       480
     gattgtgccc tccgcctcaa cgtgatggca gattacactt atgtgcagga aacccttata       540
     caagcatcgt attacgacat ggcttatacc gaagttccaa ttgaattcag aaaaagagaa       600
     ggatcttcaa gactcatttc taatattttc aattacgcca gacgtgcggg aaccacaatt       660
     gccagaggtt acagagactt tcacccattg aaaacctttt ctgcaatagc agggatcttt       720
     ttattagccg gattcgtgac tggtggaagg gttttggtca attatttcaa cacaggtgct       780
     gtgggacctt atttaccttc tgcaattttg acagtccttt tgtttgtgat agcaattctt       840
     gtatttattg tcgcattggt tgctgatatg ttgaaaaccc atcgaaaaat acaggatgaa       900
     atgctataca ggttgaagaa aatcgaactt gaggaataa                              939
//

If you have problems or comments...

PBIL Back to PBIL home page