(data stored in SCRATCH3701 zone)

EMBL: CP001994.PE97

CP001994.PE97        Location/Qualifiers
FT   CDS_pept        104835..105752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0099"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR001845; SPTR: Q8TN72 Putative
FT                   uncharacterized protein; PFAM: Sugar-specific
FT                   transcriptional regulator TrmB"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35635"
FT                   /db_xref="GOA:D5E8X6"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR002831"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D5E8X6"
FT                   /protein_id="ADE35635.1"
FT                   /translation="MLNLTTIEIFKHLTHPKTVSEISTLLKLDHSTISKSINSLVESGL
FT                   VVRRKQGRYTYVTRSESLHSRSLKDILIEYPRLPLNNILTSSALTILAVLNNSCSISDI
FT                   ATKTGLNRKTVAYTIGQLAKYGIVLQENKKYFFSKRHSLIRSFVDNYWKYRTNKTLKEI
FT                   SPNAVLLWQRGPEILFKIDNDFIDSDKPVKKESIHPTAMNIFPKYGLKVISDLGYYFYS
FT                   KRDLKAEDYVIHTLLIDPYSPIYNSYALALYSKTGSTELVKFGKLYDMEDHTKTLQEYL
FT                   RIKEKNSSFLLPWNEFIDLIKDIQ"
     atgctgaatt tgactacaat cgaaatattc aaacacctga ctcatccaaa aaccgtatct        60
     gaaatttcaa cacttctgaa actggaccat tccacaattt ccaaatcaat aaattcactc       120
     gttgaatcag gtttagttgt aagacgaaaa caaggtcgtt acacctatgt aactcgttct       180
     gaatcgctgc attccagatc attgaaagat attctcatcg aatatccccg tctgccacta       240
     aacaatatcc ttacaagttc agcactaact atattggcag tcctgaataa ttcatgttcg       300
     atcagtgata ttgctacaaa aaccggattg aatagaaaaa cggtggcata tactattgga       360
     caactcgcaa aatatggaat cgtcctgcaa gagaataaga aatacttttt tagtaaacgg       420
     cattctttaa tcagaagctt tgttgataac tattggaaat acaggacaaa taaaaccctg       480
     aaagaaattt ctccaaatgc ggttttgctc tggcaaaggg gaccggaaat tttgttcaaa       540
     atcgataatg attttattga ttctgataaa ccggtgaaaa aagaatcgat acatcctact       600
     gcaatgaata tatttccaaa atatggtcta aaggtcataa gtgatctggg gtattatttc       660
     tacagtaaaa gagatctcaa agctgaagat tatgtgattc acacgctcct gatagaccca       720
     tatagtccaa tatacaattc ttatgcattg gccctttact cgaaaacagg atcaacagaa       780
     ttggtaaaat ttggtaaatt gtacgatatg gaagatcata ccaaaaccct tcaggaatat       840
     ttacgaataa aggaaaaaaa tagtagtttc cttcttccat ggaacgaatt cattgatttg       900
     ataaaagaca tacaataa                                                     918
//

If you have problems or comments...

PBIL Back to PBIL home page