(data stored in ACNUC30630 zone)

EMBL: CP002000.ACPP

CP002000.ACPP        Location/Qualifiers
FT   CDS_pept        222565..222837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acpP"
FT                   /locus_tag="AMED_0210"
FT                   /product="acyl carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42033"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CUR8"
FT                   /protein_id="ADJ42033.1"
FT                   /translation="MSAELNAQAAGPLAPKLREVFVEALDLDGGVDVENLKYRDIEAWD
FT                   SVGHMALVAAIEDEFDVEFDTDQVIDMSSFKVAVDMVTELQSKND"
     atgtcggctg aattgaacgc tcaggccgcg gggccgcttg cccccaagct gcgcgaggtc        60
     ttcgtcgagg cgctggacct cgacggcggt gtggacgtcg agaacctgaa gtaccgcgac       120
     atcgaggcgt gggactcggt cggccacatg gcgctggtcg cggccatcga ggacgagttc       180
     gacgtcgagt tcgacaccga ccaggtcatc gacatgtcga gcttcaaggt cgccgtcgac       240
     atggtgaccg agctgcagtc gaagaatgac tga                                    273
//

If you have problems or comments...

PBIL Back to PBIL home page