(data stored in ACNUC30630 zone)

EMBL: CP002000.DNAA

CP002000.DNAA        Location/Qualifiers
FT   CDS_pept        1..1644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="AMED_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41827"
FT                   /db_xref="GOA:A0A0H3CT75"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CT75"
FT                   /protein_id="ADJ41827.1"
FT                   /translation="MSDHQHNLGVIWEQVVRELSDGTLSPQQRAWMRVTRPIGLLDGTA
FT                   LLAAPSDFAKEAIERGLRGAITDALSRRLGRAISLAVKVDSAEAVAPAPAPHYAPSPGR
FT                   VENGTSPEPAPPMPANGAPMMPPPRPAEPAQQRPPMPRPPMSMPAHQSVAPKPDDGDDT
FT                   DEEVDEEGEALAAVHEIWPTFSGQPIAGQPYTAPAQPQTSKTKLNEKYTFDTFVIGASN
FT                   RFAHAAAVAVAEAPARAYNPLFIWGESGLGKTHLLHAVGHYAQRLFPGMRVRYVSTEEF
FT                   TNDFINSLRDDRKVAFQRRYRDIDILLVDDIQFLEGKEGTQEEFFHTFNTLHNANKQIV
FT                   VSSDRPPKRLETLEDRLRTRFEWGLITDIQPPELETRIAILRKKAAQDRLAVPGEVLEF
FT                   IASRVEANIRELEGALIRVTAFASLNQQPVDSALAEIVLRDLIPDSHAPEITAPTIMGV
FT                   TSEFFDVTLDDLCGPGKTKALATARQIAMYLCRELTDMSLPKIGQTFGGRDHTTVMHAD
FT                   KKIRKEMAERRRIYDQVQELTSRIKQRARQ"
     gtgtcggatc accagcacaa tctgggtgtc atctgggaac aggtggtacg cgaactgtcc        60
     gacgggaccc tgtcccccca gcagcgcgcc tggatgcgcg tgacccgccc gatcggcctg       120
     ctcgacggca cggcgctcct ggcggcgccc agcgacttcg cgaaggaagc gatcgaacgc       180
     gggctgcgcg gcgcgatcac cgacgccctt tcccggcggc tcggccgcgc catctcgctc       240
     gcggtgaagg tcgacagcgc cgaggccgtc gctccggcgc ccgcgcccca ctacgcgccg       300
     tcacccggcc gagtggaaaa cggcacgagt cccgaaccgg cccccccgat gccggccaac       360
     ggcgcgccga tgatgccgcc gcctcggccc gccgaacccg cgcagcagcg gccaccgatg       420
     ccgcggccgc cgatgtcgat gccggcgcac cagtccgtcg caccgaagcc ggacgacggc       480
     gacgacaccg acgaagaagt cgacgaagag ggcgaagcgc tcgccgcggt ccacgagatc       540
     tggccgacgt tctccggcca gccgatcgcc ggccagccgt acaccgcgcc ggcgcagccg       600
     cagacgtcca agaccaagct gaacgagaag tacaccttcg acacgttcgt catcggcgcg       660
     tccaaccgct tcgcgcacgc ggccgcggtc gccgtcgccg aagcgcccgc ccgcgcgtac       720
     aaccccctct tcatctgggg cgagtccggg ctcggcaaga cgcacctgct gcacgcggtc       780
     ggccactacg cgcaacggct cttcccgggc atgcgcgtcc ggtacgtctc gaccgaagag       840
     ttcaccaacg acttcatcaa ctcgctgcgc gacgaccgca aggtcgcctt ccagcggcgc       900
     taccgcgaca tcgacatcct gctcgtcgac gacatccagt tcctggaggg caaggaaggg       960
     acgcaggaag agttcttcca caccttcaac accctccaca acgcgaacaa gcagatcgtc      1020
     gtcagctccg accgcccgcc gaagcgcctc gaaacgctgg aggaccggct gcggacgcgg      1080
     ttcgagtggg gcctcatcac cgacatccag ccgcccgagc tcgagacgcg catcgcgatc      1140
     ctccgcaaga aggcggcgca ggacaggctg gcggtgccgg gcgaagtcct ggagttcatc      1200
     gcttcgcgcg tcgaagcgaa catccgggaa ctcgaaggcg cactaatccg cgtcaccgcg      1260
     ttcgcgtcgc tgaaccagca gccggtcgac agcgcactcg ccgagatcgt gctgcgcgac      1320
     ctgatccccg actcgcacgc accggagatc accgcgccga ccatcatggg cgtcacgtcc      1380
     gagttcttcg acgtcacgct cgacgacttg tgcggccccg gcaagacgaa ggcgctcgcc      1440
     acggcccgcc agatcgccat gtacctctgc cgcgagctca ccgacatgtc gctgccgaag      1500
     atcgggcaga cgttcggcgg ccgcgaccac acgaccgtca tgcacgcgga caagaagatc      1560
     cgcaaggaga tggccgagcg ccggcggatc tacgaccagg tgcaggagct gacgtcacgc      1620
     atcaagcagc gcgcccgcca gtag                                             1644
//

If you have problems or comments...

PBIL Back to PBIL home page