(data stored in ACNUC30630 zone)

EMBL: CP002000.DNAN

CP002000.DNAN        Location/Qualifiers
FT   CDS_pept        2524..3657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaN"
FT                   /locus_tag="AMED_0002"
FT                   /product="DNA polymerase III subunit beta"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41828"
FT                   /db_xref="GOA:A0A0H3CU86"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CU86"
FT                   /protein_id="ADJ41828.1"
FT                   /translation="MKIRVERDGLADAVAWVARSLPSRPPVPVLGGVLLDAGSDGETDA
FT                   LTVSGFDYEVSATVGVPATIADGGRLLVSGRLLADITKALPAQPVEISVDGARATITCG
FT                   TARFSLPTMPVEDYPQLPSQPAFAGELAGDAFGQAVTQVVVAAGKDDTLPMLTGMRLEI
FT                   SGSSLTLVATDRFRLAMREFTWQPAEGLADAAVLVPARTLAEAAKTLGASGATIRLALA
FT                   SGEGLLGLSGSGRYTTTRLLDAEFPPYRQLLPASHSSRAVIDVSALTESIKRVSLVAER
FT                   GTQVRLEFGDNTLRLSAGGDDEGSAEEELQVEYEGEPVTIAFNPGYLVDGLGALHSDRA
FT                   ELTFTTPNRPALIKPADAEGNVVPGYLYLLMPVRLPG"
     atgaagatcc gcgtcgagcg tgacgggctc gccgacgccg tcgcgtgggt ggccagaagc        60
     ctcccctccc ggcctccggt gccggtgctg ggcggtgtcc tcctcgacgc cggttcggac       120
     ggcgaaaccg acgcgctgac ggtctccggc ttcgactacg aggtctccgc cacggtcggg       180
     gtccccgcga cgatcgccga cggcggccgc ctgctcgtgt ccgggcgcct cctcgccgac       240
     atcaccaagg cgctgcccgc gcagccggtc gagatctccg tcgacggcgc gcgcgccacc       300
     atcacctgcg gcaccgcgcg gttctccctg ccgaccatgc cggtcgagga ctacccgcag       360
     ctgccgtccc agcccgcctt cgcgggcgag ctcgccggcg acgcgttcgg ccaggccgtc       420
     acccaggtcg tcgtcgccgc gggcaaggac gacacgctgc cgatgctcac cggcatgcgg       480
     ctcgagatct ccggcagctc gctgaccctg gtcgccaccg accggttccg gctcgccatg       540
     cgcgagttca cctggcagcc cgccgagggc ctggccgacg ccgcggtgct cgtcccggcg       600
     cgcaccctcg ccgaggcggc caagacgctc ggcgccagcg gcgccacgat ccgcctcgcc       660
     ctcgccagcg gtgaaggcct gctcggcctg tccggttccg ggcgctacac gacgacccgc       720
     ctgctcgacg cggaattccc gccgtaccgc cagctgctgc ccgcgtcgca ctcgtcgcgc       780
     gcggtgatcg acgtgtcggc gctcacggag agcatcaagc gcgtttcgct ggtggccgag       840
     cgggggactc aggtacgact ggaattcggg gacaacacgc tgcggttgtc cgcgggcggc       900
     gacgacgagg gcagcgccga ggaagaactc caggtcgagt acgaaggtga gccggtgacg       960
     atcgcgttca acccgggtta cctcgtcgac ggtctgggcg cgctgcacag cgaccgggcg      1020
     gagctgacgt tcaccacgcc gaaccggccc gcgctcatca agcccgccga cgccgagggc      1080
     aacgtcgtcc ccggttacct ctacctcctg atgccggtcc gcctcccggg ctga            1134
//

If you have problems or comments...

PBIL Back to PBIL home page