(data stored in ACNUC30630 zone)

EMBL: CP002000.GYRB

CP002000.GYRB        Location/Qualifiers
FT   CDS_pept        6668..8635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrB"
FT                   /locus_tag="AMED_0006"
FT                   /product="DNA gyrase subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41832"
FT                   /db_xref="GOA:A0A0H3CT81"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CT81"
FT                   /protein_id="ADJ41832.1"
FT                   /translation="MTENKHEYNASSITVLEGLEAVRKRPGMYIGSTGERGLHHLVQEV
FT                   VDNSVDEAMAGHATKVEVTLLADGGVRVVDDGRGIPVDMHPKEQKPTLEVVLTVLHAGG
FT                   KFDSDSYAVSGGLHGVGVSVVNALSKKLLAEVKYGGRSWRQEYTDQIPGPLEDLGPASE
FT                   TGTTITFWADGDIFETTTYNFETISRRLQEMAFLNKGLTLSLRDERVADEEAEADAEGK
FT                   VARVKEKTYCYPGGLEDFVKHINGSKDPIHSSVISFEAKGTGLEVEVAMQWNNGFTPSV
FT                   YTFANTINTHEGGTHEEGFRAALTRVVNTYARDKKLLKEKDTNLTGDDVREGLAAIVSI
FT                   KLSEPQFEGQTKTKLGNSEAKTFVQQTSNEWLADWFERNPTEAKTIINKSISSAQARMA
FT                   ARKARDLVRRKGALDIGGLPGKLKDCRSTKPEECELYIVEGDSAGGSAKEGRDSMYQAI
FT                   LPIRGKIINVEKARIDRVLKNTEVQSLITALGTGIHDEFDLEKLRYHKIVLMADADVDG
FT                   QHITTLLLTLLFRFMTPLIEHGHVFLSRPPLYKIKWPRAEPEYAYSDRERDAVIQAGVE
FT                   AGKRLPKDDAIQRYKGLGEMNAEELWETTMDPANRLLGQVTLDDAAQADELFSVLMGED
FT                   VEARRSFITRNAKDVRFLDV"
     gtgaccgaga acaagcacga gtacaacgcg tcgtcgatca cggtgctcga aggcctcgaa        60
     gcggtccgca agcgccccgg catgtacatc ggttccaccg gtgaacgcgg cctgcaccac       120
     ctcgtccagg aggtcgtcga caactccgtc gacgaggcga tggccgggca cgccaccaag       180
     gtcgaggtta ccctcctcgc cgacggcggc gtccgcgtcg tcgacgacgg ccgcggtatc       240
     ccggtcgaca tgcaccccaa ggagcagaag ccgaccctcg aggtcgtgct caccgtcctc       300
     cacgcgggcg gcaagttcga cagcgactcc tacgcggtgt ccggcggcct gcacggcgtc       360
     ggtgtctcgg tggtgaacgc gctgtcgaag aagctgctcg ccgaggtcaa gtacggcggc       420
     cgcagctggc gccaggagta caccgaccag atccccggcc cgctcgagga cctcggcccg       480
     gcgagcgaga ccggcaccac gatcaccttc tgggccgacg gcgacatctt cgagaccacg       540
     acgtacaact tcgagaccat ctcgcgccgg ctccaggaga tggcgttcct caacaaggga       600
     ctgacgctgt ccctgcgcga cgagcgcgtc gccgacgagg aggcggaggc ggacgccgag       660
     ggcaaggtcg cgcgggtcaa ggagaagacc tactgctacc cgggtggcct cgaggacttc       720
     gtcaagcaca tcaacggcag caaggacccg atccactcca gcgtgatctc cttcgaagcg       780
     aagggcaccg gcctcgaggt cgaggtcgcg atgcagtgga acaacggctt cacgccgtcg       840
     gtctacacgt tcgccaacac gatcaacacc cacgagggcg gcacccacga agagggcttc       900
     cgcgccgcgc tgacccgcgt cgtcaacacc tacgcgcgcg acaagaagct gctcaaggag       960
     aaggacacca acctgaccgg tgacgacgtg cgcgagggcc tcgccgcgat cgtctcgatc      1020
     aagctgtccg agccgcagtt cgagggccag accaagacca agctgggcaa cagcgaggcc      1080
     aagacgttcg tgcagcagac gtcgaacgag tggctggccg actggttcga gcgcaacccc      1140
     accgaggcga agacgatcat caacaagtcg atctcctcgg cgcaggcccg gatggccgcg      1200
     cgcaaggcgc gtgacctggt ccgccgcaag ggcgcgctcg acatcggcgg cctgcccggc      1260
     aagctgaagg actgccgctc caccaagccg gaggagtgcg agctctacat cgtcgagggt      1320
     gactcggccg gcggctccgc caaggagggc cgcgactcga tgtaccaggc gatcctgccg      1380
     atccgcggca agatcatcaa cgtcgagaag gcccgcatcg accgcgtcct caagaacacc      1440
     gaggtccagt cgctgatcac cgcgctcggc accggcatcc acgacgaatt cgacctcgag      1500
     aagctgcgct accacaagat cgtgctgatg gccgacgccg acgtcgacgg ccagcacatc      1560
     accacgctgc tgctcaccct gctgttccgg ttcatgacgc cgctgatcga gcacggccac      1620
     gtcttcctct cgcggccgcc gctgtacaag atcaagtggc cgcgggccga gccggagtac      1680
     gcgtactccg accgcgagcg cgacgccgtc atccaggcgg gcgtcgaggc cggcaagcgg      1740
     ctgccgaagg acgacgcgat ccagcgctac aagggtctcg gcgagatgaa cgccgaagag      1800
     ctgtgggaga ccacgatgga cccggccaac cggctgctgg gccaggtcac cctcgacgac      1860
     gccgcccagg ccgacgagct gttctcggtc ctgatgggcg aggacgtcga ggcccgccgc      1920
     tcgttcatca cgcgcaacgc caaggacgtg cgcttcttgg acgtgtag                   1968
//

If you have problems or comments...

PBIL Back to PBIL home page