(data stored in ACNUC30630 zone)

EMBL: CP002000.NUOI

CP002000.NUOI        Location/Qualifiers
FT   CDS_pept        530346..530870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoI"
FT                   /locus_tag="AMED_0528"
FT                   /product="NADH dehydrogenase I subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42348"
FT                   /db_xref="GOA:A0A0H3CVN9"
FT                   /db_xref="InterPro:IPR010226"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CVN9"
FT                   /protein_id="ADJ42348.1"
FT                   /translation="MGFLDPVKGFGVTFGMMFKKVATEEYPEAGAPAAPRYHGRHQLNR
FT                   HPDGLEKCVGCELCAWACPADAIFVEGGDNTEEARFSPGERYGADYQINYLRCIGCGLC
FT                   IEACPTRSLTMINFYELADDDRQRLIYTKEDLLAPLLPGMEQPPHPMRLGENEQDYYVN
FT                   GPELARGEGIK"
     atggggtttc ttgatcccgt caagggcttc ggcgtcacct tcgggatgat gttcaagaag        60
     gtcgccaccg aggaataccc ggaggccggc gcgccggccg caccgcggta ccacggacgg       120
     caccagctga accgccaccc ggacggtctc gagaagtgcg tcggctgcga gctgtgcgcg       180
     tgggcgtgcc cggcggacgc gatcttcgtc gaaggtggtg acaacaccga ggaagcccgg       240
     ttctcgccgg gcgagcggta cggcgcggac taccagatca actacctgcg ctgcatcggc       300
     tgcggcctct gcatcgaggc gtgcccgacc cggtcgctga cgatgatcaa cttctacgag       360
     ctggccgacg acgaccgcca gcggctgatc tacacgaagg aagacctgct cgccccgctg       420
     ctgcccggca tggagcagcc gccgcacccg atgcggctcg gcgagaacga gcaggactac       480
     tacgtgaacg gccccgaact ggcgcgcggg gaggggatca agtga                       525
//

If you have problems or comments...

PBIL Back to PBIL home page