(data stored in ACNUC30630 zone)

EMBL: CP002000.PE105

CP002000.PE105       Location/Qualifiers
FT   CDS_pept        complement(112956..113351)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0107"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41931"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CX71"
FT                   /protein_id="ADJ41931.1"
FT                   /translation="MAGQWAPRDHEELTAGWRLWLELDSSGWPRPDWDGSPDEAVRGLQ
FT                   ELVHAADEILAQYLAGGGPAEAEVPGLIRSLQLSASWIRELWAGDTTPLDGERMALLHS
FT                   DLAGFAGHARGVRTLLAEGGGWASLTL"
     atggccgggc aatgggcgcc gcgtgaccac gaggagctga ccgcgggctg gcggttgtgg        60
     ctcgaactcg actcgtccgg ctggccccgg ccggactggg acggcagtcc ggacgaggcc       120
     gtgcgtgggc ttcaggagct ggtccacgcc gccgacgaga tcctggccca gtacctggcc       180
     gggggcgggc cggccgaggc cgaagtgccg gggctgatcc ggtccctgca gctgtcggcc       240
     agctggatcc gggagctgtg ggcgggcgac accacaccgc tcgacgggga acggatggcc       300
     ctgctgcaca gcgatctcgc cgggttcgcc ggccacgccc gcggcgtgcg cacgctgctc       360
     gccgagggcg gcgggtgggc ctcgctgacg ctctaa                                 396
//

If you have problems or comments...

PBIL Back to PBIL home page