(data stored in ACNUC30630 zone)

EMBL: CP002000.PE107

CP002000.PE107       Location/Qualifiers
FT   CDS_pept        complement(114938..115822)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0109"
FT                   /product="glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41933"
FT                   /db_xref="GOA:A0A0H3CUH6"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="InterPro:IPR041581"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CUH6"
FT                   /protein_id="ADJ41933.1"
FT                   /translation="MPEPFDALRRPSERVAPDPDFAAELRDDLRRAILNGADMTTTAVP
FT                   ATAASLRSLTPYLAVSDARAALDFYVEVFGAVRRGDPILMDDGRVGHAELAIGDAVLML
FT                   AEEYPEIGHVAPREGGASVRVEVPDVDGSVARALELGATLIRAVSDSPYGRGGSFRDPF
FT                   GQRWLVSQAATAAAGPRPARHGEAMYFTFQVPEASPAKAFYGAVLGWQFTPGSTTDSWG
FT                   FSGPGLEGGLWAGDRQVGWKLMYAVDDLESAMARVREQGGRAGEVEHHPYGNTADCTDN
FT                   QGIEFWLWEKPGQ"
     atgcctgagc ctttcgacgc gcttcgccgt ccctccgagc gggtcgcccc cgacccggac        60
     ttcgccgccg aactacgcga cgacctgcgt cgcgcgatct tgaacggagc cgatatgacg       120
     accaccgcag tcccagccac tgctgcctcc ctgcgttcgc tgacgcccta cctggcggtt       180
     tccgacgccc gcgcggcact cgacttctac gtggaggtgt tcggcgcggt ccgccgcggc       240
     gacccgatcc tgatggacga cggccgcgtc gggcacgcgg agctggccat cggcgacgcg       300
     gtgctgatgc tcgccgagga gtacccggag atcggccacg tggccccgcg cgagggtggc       360
     gcgtcggtgc gggtcgaggt cccggacgtg gacggttcgg tggctcgcgc gctggagctg       420
     ggcgcaacgc tgatccgcgc ggtgagcgat tcgccgtacg gcaggggcgg ctcgttccgc       480
     gacccgttcg gccagcgctg gctggtgtcc caggcggcga cggcggctgc cggcccgcgg       540
     ccggcccgcc acggcgaggc catgtacttc acgttccagg tcccggaggc ttcgcccgcg       600
     aaggcgtttt acggcgcggt gctgggctgg cagttcaccc cgggctcgac gacggactcg       660
     tggggcttct cggggccggg tctcgaaggc gggctgtggg ccggggaccg gcaggtgggc       720
     tggaagctga tgtacgcggt cgacgacctc gagtcggcga tggcgcgggt gcgggagcag       780
     ggtgggcggg ctggggaggt cgagcaccac ccgtacggga acactgctga ctgcacggac       840
     aaccagggga tcgagttctg gctgtgggaa aagccgggcc agtag                       885
//

If you have problems or comments...

PBIL Back to PBIL home page