(data stored in ACNUC30630 zone)

EMBL: CP002000.PE11

CP002000.PE11        Location/Qualifiers
FT   CDS_pept        complement(16129..17685)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0012"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41837"
FT                   /db_xref="InterPro:IPR022081"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CT85"
FT                   /protein_id="ADJ41837.1"
FT                   /translation="MSGFDDTLSVIDFVISDEPAPHCQQCGRPRSDSPSGDFCSENCQR
FT                   VWRGRHTAAKPAEDGGAQPSELPEAAPVNPLTWLGPAPVGAFAKPGHEVLDAVVTFVSR
FT                   FSAFANEHAAPTLALWYAHTHVAERLYVTPRLILDSAEPGSGETRVLEVAQYLVAKPEM
FT                   TISITPAAIFRMLADGPMTLLFDEIDAVFNPKTGGNNEDLRALLNAGYKRSATVTRCVG
FT                   DAKSMNVTRFPVYAPVALAGIAGGMPDTITTRAITVHMRKRRFDEAVEEFIEEDVERES
FT                   APVRAELAEWVGRVGDEVSRARPDRPDGVRDRAAEIWRPLLAIADAAGGHWPETARKAC
FT                   RHFVLEATAQPASIGVRLLADVRQIFTAEHTDRMVTAELIRELHAIEDEPWTDLQGKPL
FT                   DSRRLAEELDRYLVRPKDLKVSDKTLKGYRIDGDGGLADAWSRYLPPPETGATSATNAT
FT                   PQVTATSGVAEAPSSAATSATRVADGRGTQQPLAPALTSPVAEVADVAPAKPDHDTEWD
FT                   R"
     atgtccggat tcgacgacac cttgtccgtg atcgacttcg tgatctccga cgagcctgcg        60
     ccccactgcc agcagtgcgg ccggccgcgc agcgactcgc cgtccggcga cttctgctcg       120
     gagaactgcc agcgcgtctg gcgcggccga cacaccgcgg ccaagccagc cgaggacggc       180
     ggcgcccagc cgagcgagct gccggaggcc gcgccggtca acccgctcac gtggctcggg       240
     ccggcgccgg tcggggcctt cgcgaagccg ggtcacgagg tcttggacgc ggtcgtgacg       300
     ttcgtgtcgc ggttctcggc cttcgcgaac gagcacgccg cgccgacgct ggcgctttgg       360
     tacgcgcaca cccacgtcgc cgaacggctc tacgtcacgc cgcgcctcat cctcgactcg       420
     gcggagccgg gcagcggcga gacgcgcgtg ctggaggtcg cgcagtacct cgtggccaag       480
     ccggagatga cgatcagcat caccccggcc gcgatcttcc gcatgctcgc cgacggcccg       540
     atgacgctgc tgttcgacga gatcgacgcc gtgttcaacc cgaagaccgg cgggaacaac       600
     gaggacctcc gcgccctgct gaacgcgggc tacaagcggt cggcgacggt gacccggtgc       660
     gtcggcgacg ccaagagcat gaatgtgacc cggttcccgg tctatgcgcc ggtcgccctc       720
     gccgggatcg ccggcggcat gccagacacg atcacgaccc gggcgatcac cgtgcacatg       780
     cgcaagcgcc gattcgacga ggcagtagag gagttcatcg aagaggacgt cgagcgcgag       840
     tcggcgccgg tgcgcgccga actggcggag tgggtcggcc gggtcggcga cgaggtgagc       900
     cgcgcacggc cagaccgacc ggacggcgtg cgcgaccggg cggccgagat ctggcggccg       960
     ctgctggcga tcgccgacgc ggccggcggg cactggccgg agaccgcgcg caaggcgtgc      1020
     cgtcacttcg tgctcgaagc cactgcgcaa ccggcctcga tcggcgtgcg gctgctggcc      1080
     gacgtccggc agatcttcac ggcggagcac accgaccgca tggtgacggc cgagctgatc      1140
     cgcgagctgc acgccatcga agacgaaccg tggaccgacc tgcagggcaa gccgctcgac      1200
     agccgccgtc tcgcggagga actcgaccgg tacctggtcc ggccgaaaga cctcaaggtc      1260
     agcgacaaga cgctcaaggg ctaccgcatc gacggcgacg gcggcctggc cgacgcctgg      1320
     agccgctacc tcccaccgcc cgaaacgggc gctacctccg cgaccaacgc gaccccgcag      1380
     gtcaccgcca catccggcgt cgcggaggcg ccgagctcgg ccgcgacctc cgcaacccgg      1440
     gtcgcggacg gtcgcggcac ccaacagcca ctcgcacccg cactgaccag cccggttgcg      1500
     gaggtcgcgg acgtcgcgcc cgccaaaccg gaccacgaca ccgagtggga ccgatga         1557
//

If you have problems or comments...

PBIL Back to PBIL home page