(data stored in ACNUC30630 zone)

EMBL: CP002000.PE111

CP002000.PE111       Location/Qualifiers
FT   CDS_pept        118845..119924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0113"
FT                   /product="two-component system histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41937"
FT                   /db_xref="GOA:A0A0H3CTG9"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CTG9"
FT                   /protein_id="ADJ41937.1"
FT                   /translation="MARAVVVGVFVIGATSASSRWQPGASPLTPIGFAWLAATVLTLLL
FT                   VHRFPLTLFLVAAASAFGYYTSGLPGGPVIVVPTIALFVLTRQRGPLTAGITGASALAA
FT                   AYVVHVITTRSFALETGAAFLVVWLTAVIGVGTAVRYQLDALAARRGQADEHRHRLAEQ
FT                   ERLRIAREVHDVVAHSLAMINVQAGVAAHVADRRPEQAKEALLNIKAASASALKDLRAT
FT                   LAVLRSGEDKAPAPSLAQAGELLDHARDAGLTVEVHGEPGDLPAPVDAAAYRILQESLT
FT                   NVVRHADQPHRVDVRFERRPGAVTLRVRDDGRGTAQPTPGHGLRGMGERAAALGGRCTA
FT                   GPVDGGFEVCVELPIEGEA"
     gtggcgcgcg ccgtcgtcgt cggggtcttc gtgatcgggg cgaccagtgc gtcgtcgcgg        60
     tggcagcccg gggcgtcgcc gctgacgccg atcggtttcg cgtggctcgc cgcgaccgtc       120
     ctcacgctgc tgctcgtcca ccgcttcccg ctgacgctct tcctggtcgc ggccgcctcc       180
     gcgttcggct actacacctc cggcctgccc ggcggcccgg tcatcgtggt cccgaccatc       240
     gcgttgttcg tgctgacccg gcagcgcgga cccctcaccg cgggcatcac cggtgcctcg       300
     gccctcgccg ccgcctacgt cgtgcacgtc atcacgacca ggtctttcgc gttggaaacc       360
     ggggccgcgt tcctcgtcgt ctggctgacc gccgtgatcg gggtcgggac cgccgtccgg       420
     taccagctcg acgcgctcgc cgcccgccgc ggccaggccg acgagcaccg ccaccggctc       480
     gccgagcagg aacggctgcg catcgcccgc gaggtgcacg acgtcgtcgc gcacagcctg       540
     gcgatgatca acgtccaggc gggggtcgcc gcgcacgtcg ccgaccggcg gcccgagcag       600
     gcgaaagagg cgttgctgaa catcaaggcg gcgagcgcgt ccgcgctgaa ggacctgcgc       660
     gccaccctgg ccgtgctgcg gtccggggag gacaaggcgc ccgccccgag tctcgcgcag       720
     gccggcgagc tgctggacca cgcccgcgac gccgggctca cggtcgaggt ccacggcgaa       780
     cccggcgacc tcccggcccc ggtcgacgcc gccgcctacc ggatcctgca ggagtcgctg       840
     accaacgtcg tccggcacgc cgaccagccc caccgcgtcg acgtccggtt cgagcggcga       900
     ccgggggccg tcacgctccg ggtccgcgac gacggccgtg gcaccgccca gccgaccccg       960
     ggccacggcc tgcggggcat gggcgaacgc gccgcggcgc tcggcggccg gtgcaccgcc      1020
     gggccggtcg acggcggttt cgaagtgtgc gtcgagctac cgatcgaggg ggaagcatga      1080
//

If you have problems or comments...

PBIL Back to PBIL home page