(data stored in ACNUC30630 zone)

EMBL: CP002000.PE116

CP002000.PE116       Location/Qualifiers
FT   CDS_pept        complement(125045..126178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0118"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41942"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CTH3"
FT                   /protein_id="ADJ41942.1"
FT                   /translation="MAPDRLAAALARLDEHRELHLPLRRTDLLGRLALRFLWKRQVKWQ
FT                   VEANLAVRDALVAVHELVRAHHEQLGEAGGHGVVRVDHLARELDQLRQQDQTMTAGLNQ
FT                   RLYSGLGRLETQLSDLRLQQAQTAEAETDAEQRLKSLEAQVAALSSTAADVRLRHAQLD
FT                   VALDRIRAGQPVPEVAPAVADRESFLELALSELLDGPADHVRTARRAHLPLVSAAREAG
FT                   ATGPVFDAAPARGEWLEVLRSAGLPYRAASGNSLVRQHCAGLGLDVEPAEPLAALAAVP
FT                   QRSLGAVTAFRFAERLTPGAFARFADLAATALQPGGVLLVELPGDGEAGLDPFAVTPPH
FT                   PIYLRFVAESAGFGDVEVRASEPVGGLGERRCLIARR"
     atggctcctg accgcttggc cgccgcactg gctcgcctcg acgaacaccg cgagctgcac        60
     ctgccgctgc gccggaccga cctgctcggc cgcctggccc tgcggttcct ctggaagcgc       120
     caggtgaagt ggcaggtcga ggccaacctc gccgtccgcg acgcgctggt ggccgtgcac       180
     gagctggtcc gcgcgcacca cgagcagctg ggcgaagccg gtggccacgg tgtcgtccgc       240
     gtcgaccacc tggcccgcga gctcgaccag ctccggcagc aggaccagac gatgacggcc       300
     gggctgaacc agcggctgta ctccgggctc ggccggctcg aaacccagct cagcgacctg       360
     cggctgcagc aggcgcaaac ggccgaagcc gaaacggacg ccgagcagcg cctgaagtcg       420
     ctggaggccc aggtcgcggc cctcagctcg acggcggccg acgtccggct gcggcacgcc       480
     cagctggacg tggcgctcga ccggatccgc gccgggcagc cggtgcccga ggtcgccccg       540
     gcggtcgccg accgcgagtc gttcctcgag ctcgcgctgt ccgagctgct cgacggcccg       600
     gccgaccacg tccggaccgc ccgccgggcc cacctgccgc tggtttcggc ggcgcgggag       660
     gccggcgcga ccgggccggt gttcgacgcc gcacccgccc gcggggagtg gctcgaggtc       720
     ctgcggtccg ccggtctgcc gtaccgggcg gcgtcgggca actcgctcgt ccggcagcac       780
     tgcgcgggac tcggcctcga cgtcgaaccc gcggagccgc tcgccgcgct cgccgctgtt       840
     ccgcagcgtt cgctgggcgc ggtcaccgcg ttccggttcg ccgagcggct cacgcccggc       900
     gccttcgccc gcttcgccga cctggccgcg acggcgctgc agccgggcgg ggtgctcctc       960
     gtcgagctgc cgggcgacgg cgaagccggg ctggacccgt tcgccgtcac cccgccccac      1020
     ccgatctacc tgcggttcgt cgccgagtcg gcgggcttcg gcgacgtcga agtccgggcg      1080
     tcggagccgg tcggcgggct cggcgagcgc cgctgcctga tcgcccgccg atga            1134
//

If you have problems or comments...

PBIL Back to PBIL home page