(data stored in ACNUC30630 zone)

EMBL: CP002000.PE117

CP002000.PE117       Location/Qualifiers
FT   CDS_pept        complement(126203..127486)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0119"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41943"
FT                   /db_xref="GOA:A0A0H3CUI7"
FT                   /db_xref="InterPro:IPR031811"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CUI7"
FT                   /protein_id="ADJ41943.1"
FT                   /translation="MTTTGRGPRPALPPVYEAFLPREHALYRPRHGRSQLVALICAIVF
FT                   LATPGLSAVAGARPSQFENRALTPFPSFGQGWSFFPQFTRWATDHLVFREQAVHAADGI
FT                   SRGVFGEPPPLNQENQQNPLQVPVPAPDSPKYDRRQFPNVIEGKSGWLYLGDEVTSHCV
FT                   QASNLDTTFAQLRSFRDGIEASGRQLVVVVAPDKVGMVPQYLPDNYVGKDCHDAIEGDF
FT                   WRRVDAENFMIDPRRPIQDWANRKGAPVYGPQDAHWSDEGAISAVRAVVEKLRPGISAG
FT                   WRIQPKEDWQVPADLPPLIGRTGQTEGTHYALMPDGTTDRTRPMPADYIPPVHTDTATG
FT                   EGTYGLRTAWLGDSFTIRTLPYLAATFRDLTALHTSTADHDGGAAAADLLQRSDVVVIE
FT                   LAERGLVVGSVSMLSPAVQQNIFTKLAR"
     gtgaccacga ccggacgagg accccggccg gcgctgccgc cggtctacga ggcgttcctc        60
     ccgcgcgaac acgccttgta ccggccgcgc cacggccgca gccagctcgt cgcgctgatc       120
     tgcgcgatcg tcttcctcgc gacgcccggc ctgtcggccg tggccggcgc gcgcccgagc       180
     cagttcgaaa accgggcact gacgccgttc ccgagcttcg ggcagggctg gtcgttcttc       240
     ccgcagttca cccggtgggc gaccgaccac ctggtgttcc gcgagcaggc ggtgcacgcg       300
     gccgacggca tcagccgtgg cgtgttcggc gagccgccac cgctgaacca ggagaaccag       360
     cagaacccgc tccaggtccc ggtgcccgcc ccggacagcc cgaagtacga ccggcggcag       420
     ttccccaacg tgatcgaggg caagagcggc tggctgtacc tcggcgacga ggtcaccagc       480
     cactgcgtgc aggcgtccaa cctcgacacg acgttcgccc agctgcgcag cttccgcgac       540
     ggcatcgagg cgtcgggacg gcagctggtc gtggtggtcg cgccggacaa ggtgggcatg       600
     gtcccccagt acctgcccga caactacgtc ggcaaggact gccacgacgc gatcgaaggc       660
     gacttctggc gccgcgtcga cgccgagaac ttcatgatcg acccccgccg tccgatccag       720
     gactgggcga accgcaaggg cgcgccggtg tacgggccgc aggacgcgca ctggagcgac       780
     gaaggcgcga tcagcgcggt gcgggccgtc gtcgagaagc tgcggccggg catcagcgcg       840
     ggctggcgga tccagcccaa ggaagactgg caggtgccgg ccgacctgcc accgctgatc       900
     ggccggaccg ggcagaccga aggcacccac tacgcgctca tgccggatgg cacgaccgac       960
     cgcacccggc cgatgcccgc cgactacatc ccgccggtgc acaccgacac cgccaccggc      1020
     gagggcacct acggcctgcg gacggcctgg ctcggggact cgttcaccat ccggaccctg      1080
     ccgtacctgg ccgcgacctt ccgcgatctg accgccctgc acaccagcac ggccgaccac      1140
     gacggcggcg ccgcggccgc ggacctgctg cagcgcagcg acgtcgtcgt catcgagctc      1200
     gccgagcgcg ggctggtcgt cggctcggtt tcgatgctgt cgcccgccgt gcagcagaac      1260
     atcttcacca agctcgcccg ctga                                             1284
//

If you have problems or comments...

PBIL Back to PBIL home page