(data stored in ACNUC30630 zone)

EMBL: CP002000.PE133

CP002000.PE133       Location/Qualifiers
FT   CDS_pept        145263..145793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0135"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41959"
FT                   /db_xref="GOA:A0A0H3CVL1"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CVL1"
FT                   /protein_id="ADJ41959.1"
FT                   /translation="MTDDFYERRSNGVREPDPTLGRRARHRPLPQPADRAVVESLPPAP
FT                   ENEPPPKPEHHAKPKRERVILADPRRGAGSLRARVELEEQTSWGKLLVRDHLVKVQLRT
FT                   ALLLALLVVGVFGSLPVLFYLVPGFSQASLLGIPVAWLILGVLPFPFLFGVGIWYNRLA
FT                   ERNERAFVDMIEN"
     atgaccgacg acttctacga gcgccgctcg aacggcgtcc gcgaaccgga tccgaccctc        60
     ggcaggcgcg cccggcaccg gccgctgccg cagccggccg accgggccgt cgtcgagtcc       120
     ctgccgccgg cgccggagaa cgagccgccg ccgaagccgg aacaccacgc gaaacccaag       180
     cgggagcgcg tgatcctcgc cgacccgcgc cgtggcgccg gcagcctgcg cgcccgggtc       240
     gagctggagg agcagaccag ctgggggaag ctgctcgtac gcgaccacct ggtgaaggtg       300
     cagctgcgga cggcgttgct gctcgcgttg ctcgtcgtcg gcgtcttcgg ctcgctgccc       360
     gtgctgttct acctggtgcc ggggttctcc caggccagcc tgctcggcat cccggtggcc       420
     tggctgattc tcggcgtgct gccgttccca ttcctgttcg gtgtcggaat ctggtacaac       480
     cggctggccg aacgcaacga acgcgcgttc gtggacatga tcgaaaacta g                531
//

If you have problems or comments...

PBIL Back to PBIL home page