(data stored in ACNUC30630 zone)

EMBL: CP002000.PE139

CP002000.PE139       Location/Qualifiers
FT   CDS_pept        151172..152014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0141"
FT                   /product="LmbE family protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41965"
FT                   /db_xref="GOA:A0A0H3CVA5"
FT                   /db_xref="InterPro:IPR003737"
FT                   /db_xref="InterPro:IPR017811"
FT                   /db_xref="InterPro:IPR024078"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CVA5"
FT                   /protein_id="ADJ41965.1"
FT                   /translation="MTYRLLSVHAHPDDESSKCAATLARYAAEGVEVLVATCTGGERGD
FT                   VLNPALDTPETWADLPAIRRREMAAAAEILGVRQRFLGLVDSGLPAEGEPLPEGCFAAL
FT                   PLSEAAAPLVALIREFRPHVVITYDETGGYPHPDHIRTHEVTVEAFTAAADPARYPGTG
FT                   EPWQPQKLYYQATLSRAWFQALHEATLAAGLESSMAEVLNELPPDKFPVTTKIRCEAHF
FT                   ATRDRALLAHATQVDPAHPFFAHSREIERQVWPHEDYHLAHPAPGPHLEEDLFTGVTP"
     gtgacttacc gcctgttgag cgtccacgcc cacccggacg acgagtccag caagtgcgcg        60
     gccaccctgg cgcgctatgc ggctgaaggc gtcgaggtcc tggtcgccac ctgcaccggc       120
     ggcgaacgcg gcgacgtcct gaacccggcc ctcgacacgc ccgagacgtg ggcggacctc       180
     ccggcgatcc gccgtcgcga gatggccgcg gccgccgaga tcttgggcgt ccgccagcgt       240
     ttcctcggac tggtcgattc cggcctcccc gccgagggcg agcccttgcc cgagggctgc       300
     ttcgcggccc tgccgctctc ggaagcggcg gcgccgctgg tggcgctgat ccgcgagttc       360
     cgcccgcacg tggtgatcac gtacgacgaa acgggcggct acccccaccc ggaccacatc       420
     cgcacccacg aggtgacggt cgaggctttc accgcggccg ccgaccccgc ccgctatccc       480
     ggcacgggcg agccgtggca gccgcaaaag ctgtactacc aggccactct gagccgcgcc       540
     tggttccagg ccctgcacga ggcaaccctg gccgccggcc tggaatcctc aatggccgag       600
     gtcttgaacg aactcccacc cgacaaattc ccggtaacga ccaaaatccg ctgcgaggcc       660
     cacttcgcca cgcgcgaccg agccctcttg gcccacgcca cccaggtaga cccggcccac       720
     ccgtttttcg cccactcacg cgaaatcgag cgccaagtct ggccccacga ggactaccac       780
     ctcgcccacc ccgccccagg cccccacctc gaagaagacc tcttcaccgg agtaactcca       840
     taa                                                                     843
//

If you have problems or comments...

PBIL Back to PBIL home page