(data stored in ACNUC30630 zone)

EMBL: CP002000.PE149

CP002000.PE149       Location/Qualifiers
FT   CDS_pept        complement(159864..160658)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0151"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41975"
FT                   /db_xref="InterPro:IPR019595"
FT                   /db_xref="InterPro:IPR037119"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CVB4"
FT                   /protein_id="ADJ41975.1"
FT                   /translation="MTEAPTSVRRPPAPNPAERAKTIATRNGPASLLPTCDRADLNGER
FT                   VVPVLHHVHRSGSVSVLLADDHPMVRAAKQAQRGELAVMVEVADQAPVDLREPIRGLLW
FT                   ITGWLRPLSPVSARARAVAIAETRPDERLLDVGHGVTLLRLTPASLVLADAEGTHSLRP
FT                   HMFSAAPPDPFHDYEAGWLRHLESDHSDVVEQLAKHLPSALRGGRIRPLGLDRFGLRLR
FT                   VESDTGDHDVRLAFSKSVESPAQLASELRRLVGCPFLRGRSG"
     gtgaccgagg cccccacatc cgtccgccgc ccgccggcac cgaaccccgc cgagcgcgcc        60
     aagacgatcg cgacccgcaa cggccccgcg tcgttgctgc ccacctgcga ccgcgccgac       120
     ctcaacggcg agcgcgtcgt ccccgtcctg caccacgtgc accgcagtgg cagcgtcagc       180
     gtgctgctgg ccgacgacca cccgatggtc cgcgcggcga agcaggccca gcgcggggag       240
     ctggccgtga tggtcgaggt cgccgaccag gcgccggtcg acctgcggga accgatccgc       300
     gggctgttgt ggatcaccgg ctggctgcgg ccgctctcgc cggtttcggc ccgcgcgcgg       360
     gccgtggcga tcgccgagac gcggccggac gagcggctcc tcgacgtcgg ccacggcgtc       420
     acgctgctgc ggctcacccc ggcttcgctc gtgctcgccg acgccgaagg aacgcactcg       480
     ctgcgcccgc acatgttcag cgccgcgccg cccgacccgt tccacgacta cgaagccggg       540
     tggctgcggc acctggagag cgaccactcc gacgtcgtcg agcagctggc gaagcacctg       600
     ccgtcggcgt tgcgcggcgg ccggatccgc ccgctcgggc tcgaccggtt cgggctgcgg       660
     ctgcgcgtcg aatccgacac gggcgaccac gacgtgcggc tggcgttctc gaagtccgtc       720
     gaaagcccgg cgcagctcgc gtcggaactg cgccggctgg tcggctgccc gttcctgcgc       780
     gggcggtcag gctag                                                        795
//

If you have problems or comments...

PBIL Back to PBIL home page